BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000878-TA|BGIBMGA000878-PA|undefined (716 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 25 1.6 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 24 3.8 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/33 (30%), Positives = 16/33 (48%) Query: 675 TDMVRCLGITKMLPNAEDSLELVNDKKDFWKCI 707 T ++R LG+ + E V D D+W C+ Sbjct: 502 TTVMRDLGVEFQKIELKQCDEFVEDSDDYWNCV 534 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 24.2 bits (50), Expect = 3.8 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 103 PPPVSVKTTGPVWDIGQVL 121 PP V ++ TG W++G +L Sbjct: 92 PPAVLLQLTGGTWELGPML 110 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.136 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,526 Number of Sequences: 429 Number of extensions: 6196 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 3 length of query: 716 length of database: 140,377 effective HSP length: 63 effective length of query: 653 effective length of database: 113,350 effective search space: 74017550 effective search space used: 74017550 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -