BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000877-TA|BGIBMGA000877-PA|undefined (313 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 4.8 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 23 8.4 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.2 bits (50), Expect = 4.8 Identities = 14/47 (29%), Positives = 22/47 (46%) Query: 201 KKRKAPQPQQQSVPSLGHGSAKYSINTLDSSISRSTGPPPYSETATE 247 KK+ + S PS +A N + +S S +T P P T+T+ Sbjct: 914 KKQNLKFIDEASTPSTSAMAATIVPNPVQASPSPATAPAPAKTTSTD 960 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 8.4 Identities = 18/69 (26%), Positives = 29/69 (42%), Gaps = 4/69 (5%) Query: 73 DVSGYVSTPSPTKTLSPAMVKLPGRKPCCLLTTRPTKSLGNLTLATSSTMKAV----PNQ 128 D + +TP+PT T + + + P + PT + T++T + P Sbjct: 191 DPTATTTTPAPTTTTTWSDLPPPPPTTTTTVWIDPTATTTTHAPTTTTTWSDLPPPPPTT 250 Query: 129 NTTDVSTDP 137 TT V TDP Sbjct: 251 TTTTVWTDP 259 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.311 0.127 0.362 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 288,069 Number of Sequences: 2123 Number of extensions: 11031 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 19 Number of HSP's gapped (non-prelim): 3 length of query: 313 length of database: 516,269 effective HSP length: 64 effective length of query: 249 effective length of database: 380,397 effective search space: 94718853 effective search space used: 94718853 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -