BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000876-TA|BGIBMGA000876-PA|IPR000734|Lipase, IPR013818|Lipase, N-terminal (250 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 25 2.1 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 23 6.4 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 25.0 bits (52), Expect = 2.1 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 5/41 (12%) Query: 134 NGGE-FQPALAGDFIMPCFQLCSHVRAAMYWI----LAYTN 169 N GE FQ G F + FQ+ HVR + I +AYTN Sbjct: 100 NLGELFQKLTTGFFSLNLFQIGQHVRGVLVSIKSRMMAYTN 140 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/27 (29%), Positives = 16/27 (59%) Query: 164 ILAYTNPDKFLAVRCDSVADVRHGDCY 190 +++ T+PD L + C +D+R + Y Sbjct: 231 LISSTHPDTGLTIYCVKASDMRTNETY 257 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.322 0.141 0.442 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 267,719 Number of Sequences: 2123 Number of extensions: 10990 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 2 length of query: 250 length of database: 516,269 effective HSP length: 62 effective length of query: 188 effective length of database: 384,643 effective search space: 72312884 effective search space used: 72312884 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -