BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000876-TA|BGIBMGA000876-PA|IPR000734|Lipase, IPR013818|Lipase, N-terminal (250 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 23 1.7 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 22 3.9 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 3.9 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 3.9 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 9.0 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 23.4 bits (48), Expect = 1.7 Identities = 7/25 (28%), Positives = 13/25 (52%) Query: 162 YWILAYTNPDKFLAVRCDSVADVRH 186 +W + ++ D F CD+ +RH Sbjct: 71 FWTILFSRSDFFQQFECDNEPKLRH 95 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/39 (23%), Positives = 17/39 (43%) Query: 157 VRAAMYWILAYTNPDKFLAVRCDSVADVRHGDCYDGNIT 195 V A W+ + +V+ +S ++G C+ G T Sbjct: 78 VEAGFDWVYYESRAHIHCSVKSESSQAAKYGGCFSGEST 116 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 22.2 bits (45), Expect = 3.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Query: 91 PCYRNMNPKDRF 102 PC RN NP D F Sbjct: 317 PCPRNYNPADYF 328 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.2 bits (45), Expect = 3.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Query: 91 PCYRNMNPKDRF 102 PC RN NP D F Sbjct: 317 PCPRNYNPADYF 328 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/16 (43%), Positives = 10/16 (62%) Query: 9 VAMLDTFPILLRPYPI 24 + + D P L RPYP+ Sbjct: 298 IKLHDKTPFLKRPYPV 313 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.141 0.442 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,448 Number of Sequences: 317 Number of extensions: 2541 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 250 length of database: 114,650 effective HSP length: 55 effective length of query: 195 effective length of database: 97,215 effective search space: 18956925 effective search space used: 18956925 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -