BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000873-TA|BGIBMGA000873-PA|undefined (83 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 20 4.0 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 19 5.3 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 19 5.3 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 19 7.1 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 19.8 bits (39), Expect = 4.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 42 KTEHSYSLHSDVESAPPSPHHTKVDAI 68 K+ SYS + +V A SP KV+ + Sbjct: 53 KSGGSYSSNKNVSRADHSPVFGKVEPV 79 Score = 19.0 bits (37), Expect = 7.1 Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Query: 34 ALGAAAPIKTEHSYSLHS--DVE-SAPPSPHH 62 ++ A+P + + H DV+ PP PHH Sbjct: 712 SVSVASPYMLQSPLTPHEAFDVKLPPPPHPHH 743 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 19.4 bits (38), Expect = 5.3 Identities = 7/12 (58%), Positives = 9/12 (75%) Query: 25 LHDRLMTDAALG 36 LH+ +TD ALG Sbjct: 215 LHEATLTDLALG 226 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 19.4 bits (38), Expect = 5.3 Identities = 5/29 (17%), Positives = 13/29 (44%) Query: 49 LHSDVESAPPSPHHTKVDAIFMSAPYIQI 77 + + PP+PH + + +I++ Sbjct: 1 MSGEAHIGPPTPHESNTSTPVSKSAFIEL 29 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 19.0 bits (37), Expect = 7.1 Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Query: 34 ALGAAAPIKTEHSYSLHS--DVE-SAPPSPHH 62 ++ A+P + + H DV+ PP PHH Sbjct: 604 SVSVASPYMLQSPLTPHEAFDVKLPPPPHPHH 635 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.132 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,114 Number of Sequences: 317 Number of extensions: 629 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 83 length of database: 114,650 effective HSP length: 46 effective length of query: 37 effective length of database: 100,068 effective search space: 3702516 effective search space used: 3702516 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 36 (19.4 bits) S2: 36 (18.6 bits)
- SilkBase 1999-2023 -