BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000870-TA|BGIBMGA000870- PA|IPR002202|Hydroxymethylglutaryl-coenzyme A reductase (157 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F3.10 |||GARP complex subunit Vps54 |Schizosaccharomyces po... 26 3.0 SPAC9G1.09 |sid1||PAK-related kinase Sid1|Schizosaccharomyces po... 25 7.0 >SPAC2F3.10 |||GARP complex subunit Vps54 |Schizosaccharomyces pombe|chr 1|||Manual Length = 949 Score = 25.8 bits (54), Expect = 3.0 Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 105 PMDIGHNLKQLKADIKIKMADNKHXXXXXXXXXXXLVKHFFLADCMIFACHNL 157 PM I NLKQLK + + + + KH +H ACH L Sbjct: 242 PMIID-NLKQLKKETRDNVEETKHLLEKLTEVNVMCDRHMDAISSEELACHQL 293 >SPAC9G1.09 |sid1||PAK-related kinase Sid1|Schizosaccharomyces pombe|chr 1|||Manual Length = 471 Score = 24.6 bits (51), Expect = 7.0 Identities = 14/53 (26%), Positives = 31/53 (58%), Gaps = 5/53 (9%) Query: 2 ESDRDLMVAEID---KPWADPLAPGGTPWE-YDYEEIHKNFETTTIGRVARPE 50 +SD+ ++ I+ KP+ +P+A G E + +E + K+ ++T +G + P+ Sbjct: 283 DSDQSVLEETINNTLKPFEEPIAEGNADIEDWTFETVKKS-DSTVLGNTSIPK 334 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.323 0.138 0.457 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,999 Number of Sequences: 5004 Number of extensions: 17585 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 25 Number of HSP's gapped (non-prelim): 2 length of query: 157 length of database: 2,362,478 effective HSP length: 67 effective length of query: 90 effective length of database: 2,027,210 effective search space: 182448900 effective search space used: 182448900 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -