SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000870-TA|BGIBMGA000870-
PA|IPR002202|Hydroxymethylglutaryl-coenzyme A reductase
         (157 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g25360.1 68415.m03035 zinc finger protein-related contains we...    27   5.8  

>At2g25360.1 68415.m03035 zinc finger protein-related contains weak
           similarity to zinc finger proteins and Pfam PF01485: IBR
           domain
          Length = 373

 Score = 27.1 bits (57), Expect = 5.8
 Identities = 12/35 (34%), Positives = 17/35 (48%)

Query: 28  EYDYEEIHKNFETTTIGRVARPEAMTAPRGVPAWD 62
           +YDY E   +FE  T    +  EAMT    +  W+
Sbjct: 306 DYDYNEPEYDFEVDTCNYYSDEEAMTRREMIRMWN 340


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.323    0.138    0.457 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,045,504
Number of Sequences: 28952
Number of extensions: 94279
Number of successful extensions: 160
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 159
Number of HSP's gapped (non-prelim): 1
length of query: 157
length of database: 12,070,560
effective HSP length: 75
effective length of query: 82
effective length of database: 9,899,160
effective search space: 811731120
effective search space used: 811731120
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 56 (26.6 bits)

- SilkBase 1999-2023 -