SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000870-TA|BGIBMGA000870-
PA|IPR002202|Hydroxymethylglutaryl-coenzyme A reductase
         (157 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q2GMN2 Cluster: Putative uncharacterized protein; n=1; ...    32   6.7  

>UniRef50_Q2GMN2 Cluster: Putative uncharacterized protein; n=1;
          Chaetomium globosum|Rep: Putative uncharacterized
          protein - Chaetomium globosum (Soil fungus)
          Length = 294

 Score = 31.9 bits (69), Expect = 6.7
 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 18 DPLAPGGTPWEYDYEEIHKNFET-TTIGRVARPEAMTAPRG 57
          +P+ PG   W Y   + ++N  T  ++G+VA P ++  P+G
Sbjct: 42 EPVGPGDESWRYQGWQNNQNSPTPPSLGKVASPSSIAPPQG 82


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.323    0.138    0.457 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 148,408,722
Number of Sequences: 1657284
Number of extensions: 4715156
Number of successful extensions: 8144
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 8144
Number of HSP's gapped (non-prelim): 1
length of query: 157
length of database: 575,637,011
effective HSP length: 94
effective length of query: 63
effective length of database: 419,852,315
effective search space: 26450695845
effective search space used: 26450695845
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 68 (31.5 bits)

- SilkBase 1999-2023 -