BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000870-TA|BGIBMGA000870- PA|IPR002202|Hydroxymethylglutaryl-coenzyme A reductase (157 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0179 - 41814886-41815074,41815172-41815222,41815365-418154... 29 1.7 03_02_0735 + 10811326-10812342,10813199-10813555,10813962-108142... 29 2.3 02_05_0075 - 25610386-25610508,25610529-25610583,25610801-256112... 27 5.3 06_03_1285 - 28993305-28993442,28993559-28993798,28993881-289939... 27 7.0 01_04_0038 - 15339047-15339230,15339683-15339741,15340031-153401... 27 7.0 03_06_0075 - 31481395-31481452,31481675-31481964,31482068-314821... 27 9.2 >01_07_0179 - 41814886-41815074,41815172-41815222,41815365-41815469, 41815852-41815945,41816056-41816150,41816581-41816700, 41816737-41816832,41817272-41817569,41817777-41817853, 41818932-41819447 Length = 546 Score = 29.1 bits (62), Expect = 1.7 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Query: 15 PWADPLAPGGTPW---EYDYEEIHKNFETTTIGRVARPE 50 P ADP + GG+P E + E + + F+ GR++R E Sbjct: 22 PQADPASGGGSPAPTPEEEMERVFRKFDANGDGRISRSE 60 >03_02_0735 + 10811326-10812342,10813199-10813555,10813962-10814225, 10814894-10815010,10815796-10815944,10816315-10816606, 10816681-10816845,10817106-10817357 Length = 870 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Query: 4 DRDLMVAEIDKPWADPLAPGGTPWEYDYEEIHKNFETTTIGRVARP 49 D+D+++ +D+ + G W D E++H N E I +V P Sbjct: 465 DKDIILEGLDQI-EKLIQDGKFEWRTDREDVHMNIEAALIEKVGEP 509 >02_05_0075 - 25610386-25610508,25610529-25610583,25610801-25611240, 25612951-25613619,25614551-25615870 Length = 868 Score = 27.5 bits (58), Expect = 5.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Query: 13 DKPWADPLAPGGTPWEYDYEEIH 35 D+ W PG + W+YD + H Sbjct: 390 DEAWFSAWGPGSSVWDYDMDSAH 412 >06_03_1285 - 28993305-28993442,28993559-28993798,28993881-28993961, 28994370-28994429,28994523-28994628,28994861-28994921, 28995198-28995246,28995475-28995599,28995809-28995947, 28996432-28996503,28996615-28996742,28997037-28997136, 28997757-28997897,28998116-28998232,28998505-28998609, 28999037-28999153 Length = 592 Score = 27.1 bits (57), Expect = 7.0 Identities = 10/17 (58%), Positives = 12/17 (70%) Query: 92 WRKPRRRQLPLLAPMDI 108 W P RR LPLLAP ++ Sbjct: 24 WAPPLRRNLPLLAPHEV 40 >01_04_0038 - 15339047-15339230,15339683-15339741,15340031-15340160, 15340248-15340498,15340632-15341225,15342050-15342511 Length = 559 Score = 27.1 bits (57), Expect = 7.0 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 4 DRDLMVAEIDKPWADPLAPGGTPWEYDYEEIHKNFETTTIGRVAR 48 DR + V E+D P A PL E + +H T TIG VAR Sbjct: 117 DRVIEVGEVD-PAAYPLPKTKLTLENLRDVVHLRSRTNTIGAVAR 160 >03_06_0075 - 31481395-31481452,31481675-31481964,31482068-31482141, 31483099-31483351 Length = 224 Score = 26.6 bits (56), Expect = 9.2 Identities = 9/32 (28%), Positives = 17/32 (53%) Query: 32 EEIHKNFETTTIGRVARPEAMTAPRGVPAWDE 63 E+ H + + ++G+ A+P P G+P E Sbjct: 147 EKSHNSLSSNSLGQAAKPRPFPVPDGLPKTQE 178 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.323 0.138 0.457 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,947,818 Number of Sequences: 37544 Number of extensions: 126786 Number of successful extensions: 214 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 210 Number of HSP's gapped (non-prelim): 6 length of query: 157 length of database: 14,793,348 effective HSP length: 76 effective length of query: 81 effective length of database: 11,940,004 effective search space: 967140324 effective search space used: 967140324 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -