SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000869-TA|BGIBMGA000869-PA|undefined
         (67 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A5Z5T5 Cluster: Putative uncharacterized protein; n=1; ...    31   5.8  

>UniRef50_A5Z5T5 Cluster: Putative uncharacterized protein; n=1;
           Eubacterium ventriosum ATCC 27560|Rep: Putative
           uncharacterized protein - Eubacterium ventriosum ATCC
           27560
          Length = 441

 Score = 30.7 bits (66), Expect = 5.8
 Identities = 17/57 (29%), Positives = 25/57 (43%)

Query: 11  ILITNVMFLDLKHVVSYDSQSNRLDKLTHACPRGIQAAYIEFQSVLINSEFKFFELR 67
           ++I  + FL  K+ V +      L +L H C  G+ A   E    +I   F F  LR
Sbjct: 202 VMICMIHFLSKKNTVKFKWFKTSLTRLFHCCQVGMSAFVGEMSGAVIVMVFNFIILR 258


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.332    0.143    0.417 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 61,451,848
Number of Sequences: 1657284
Number of extensions: 1708503
Number of successful extensions: 4559
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4558
Number of HSP's gapped (non-prelim): 1
length of query: 67
length of database: 575,637,011
effective HSP length: 47
effective length of query: 20
effective length of database: 497,744,663
effective search space: 9954893260
effective search space used: 9954893260
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (22.0 bits)
S2: 65 (30.3 bits)

- SilkBase 1999-2023 -