BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000869-TA|BGIBMGA000869-PA|undefined (67 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 19 5.1 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 19 6.7 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 19.0 bits (37), Expect = 5.1 Identities = 9/36 (25%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Query: 1 MYLYAFVFDVILITNVMFLDLKHVVSYDSQSNRLDK 36 M+++A + + ++ V LDL+ + YD Q++ + + Sbjct: 271 MFVFAALGEFVV---VKVLDLRSQLEYDLQTSIMSR 303 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 18.6 bits (36), Expect = 6.7 Identities = 7/19 (36%), Positives = 11/19 (57%) Query: 43 RGIQAAYIEFQSVLINSEF 61 R I A YI ++++ EF Sbjct: 626 REIDAGYITIEAIIGGGEF 644 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.332 0.143 0.417 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,095 Number of Sequences: 429 Number of extensions: 419 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 67 length of database: 140,377 effective HSP length: 45 effective length of query: 22 effective length of database: 121,072 effective search space: 2663584 effective search space used: 2663584 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 35 (19.6 bits) S2: 35 (18.2 bits)
- SilkBase 1999-2023 -