Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000866-TA|BGIBMGA000866-PA|IPR000246|Peptidase T2,
asparaginase 2
         (248 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-10|CAJ14161.1|  519|Anopheles gambiae Sply, Sphingosine...    23   8.4  

>CR954257-10|CAJ14161.1|  519|Anopheles gambiae Sply,
           Sphingosine-phosphate lyase protein.
          Length = 519

 Score = 23.0 bits (47), Expect = 8.4
 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 3/40 (7%)

Query: 1   MNIGAVGGLRRIKHAISVARHV---LDHTKHSFLVGELAT 37
           MN G  G +   KH I   R++   L   K+ F+ G  AT
Sbjct: 368 MNFGLDGYVEATKHIIDTTRYIEQELRAIKNIFIFGTPAT 407


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.320    0.134    0.417 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 264,664
Number of Sequences: 2123
Number of extensions: 11102
Number of successful extensions: 20
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 20
Number of HSP's gapped (non-prelim): 1
length of query: 248
length of database: 516,269
effective HSP length: 62
effective length of query: 186
effective length of database: 384,643
effective search space: 71543598
effective search space used: 71543598
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 47 (23.0 bits)