BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000863-TA|BGIBMGA000863-PA|IPR009053|Prefoldin (517 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 26 0.55 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 24 2.2 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 23 5.1 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 23 5.1 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 23 5.1 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 23 5.1 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 23 5.1 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 8.9 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 22 8.9 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 26.2 bits (55), Expect = 0.55 Identities = 20/88 (22%), Positives = 42/88 (47%), Gaps = 2/88 (2%) Query: 144 LEEVALEIDLKKNSITKDNISIKTLLDKLITKNETDINELRNSIKYLESVKSEYNTANEK 203 L ++ ++ + NS K + IK +DK +NE + L+ S LE ++ + + Sbjct: 306 LAKIVTDLCQEANSTKKLIVKIKIDIDKEDERNEVISSALKLSQNELEITACKFFSIDNA 365 Query: 204 LFEQLNNAVDKQNCIQEEVDLLKIENQN 231 L N+ K+ ++ +D+ K + +N Sbjct: 366 LLFSANST--KKLIVKIRIDIDKEDERN 391 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 24.2 bits (50), Expect = 2.2 Identities = 12/60 (20%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 7 TLFANNENIRNIIHAFKIRLEECYKEIGQLKSGLQQNVGVGDKTVAELKNDEINSMIRQL 66 T+ N++ RN + + +C KE +LK G+ + + G + + ++++ + + L Sbjct: 30 TILKNDQMTRNYLDCV-LDKGKCTKEAEKLKKGITETMKNGCVKCEQKQKEDVHKVFQHL 88 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 23.0 bits (47), Expect = 5.1 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Query: 316 KKVNKTERELEEKQEQLTHLMEQLNDTENNSYKLIENMF 354 +K+ ++EL EK+E T +LND E ++ E++F Sbjct: 52 EKLLTEQKELAEKEEAETLKRYKLNDLEKRR-EVYESIF 89 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.0 bits (47), Expect = 5.1 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Query: 316 KKVNKTERELEEKQEQLTHLMEQLNDTENNSYKLIENMF 354 +K+ ++EL EK+E T +LND E ++ E++F Sbjct: 212 EKLLTEQKELAEKEEAETLKRYKLNDLEKRR-EVYESIF 249 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.0 bits (47), Expect = 5.1 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Query: 316 KKVNKTERELEEKQEQLTHLMEQLNDTENNSYKLIENMF 354 +K+ ++EL EK+E T +LND E ++ E++F Sbjct: 212 EKLLTEQKELAEKEEAETLKRYKLNDLEKRR-EVYESIF 249 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Query: 270 EKLSEIKEKDENFKQEIDMLNEKLICDRREFN 301 E + +I +D + + EI+M + ++ ++ EFN Sbjct: 592 ELIHKIDTEDHDIRDEIEMFSLQIANEQVEFN 623 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Query: 270 EKLSEIKEKDENFKQEIDMLNEKLICDRREFN 301 E + +I +D + + EI+M + ++ ++ EFN Sbjct: 317 ELIHKIDTEDHDIRDEIEMFSLQIANEQVEFN 348 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.2 bits (45), Expect = 8.9 Identities = 9/32 (28%), Positives = 20/32 (62%) Query: 270 EKLSEIKEKDENFKQEIDMLNEKLICDRREFN 301 E + +I+ +D + EI+M + ++ ++ EFN Sbjct: 313 ELIHQIQTEDHDIIDEIEMFSLQIANEQVEFN 344 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 22.2 bits (45), Expect = 8.9 Identities = 9/32 (28%), Positives = 20/32 (62%) Query: 270 EKLSEIKEKDENFKQEIDMLNEKLICDRREFN 301 E + +I+ +D + EI+M + ++ ++ EFN Sbjct: 344 ELIHQIQTEDHDIIDEIEMFSLQIANEQVEFN 375 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.308 0.127 0.325 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,149 Number of Sequences: 317 Number of extensions: 3669 Number of successful extensions: 19 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 11 length of query: 517 length of database: 114,650 effective HSP length: 60 effective length of query: 457 effective length of database: 95,630 effective search space: 43702910 effective search space used: 43702910 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -