GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000860-TA|BGIBMGA000860-PA|undefined
         (79 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.          19   7.3  
AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    19   7.3  

>DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.
          Length = 495

 Score = 19.0 bits (37), Expect = 7.3
 Identities = 8/13 (61%), Positives = 9/13 (69%)

Query: 33  NLGLECVTGIKAL 45
           NLG+EC   IK L
Sbjct: 467 NLGIECGYEIKKL 479


>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
           receptor 1 protein.
          Length = 953

 Score = 19.0 bits (37), Expect = 7.3
 Identities = 9/31 (29%), Positives = 16/31 (51%)

Query: 29  KQQGNLGLECVTGIKALSMIFILGGHACLFI 59
           K    LGL+ + G+  +  + I+GG   + I
Sbjct: 813 KAPNTLGLKNMAGVFIVVGVGIIGGIGLIII 843


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.323    0.136    0.400 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,111
Number of Sequences: 429
Number of extensions: 539
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of query: 79
length of database: 140,377
effective HSP length: 47
effective length of query: 32
effective length of database: 120,214
effective search space:  3846848
effective search space used:  3846848
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 36 (19.6 bits)
S2: 36 (18.6 bits)