BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000859-TA|BGIBMGA000859-PA|IPR002160|Proteinase inhibitor I3, Kunitz legume (75 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 25 0.28 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 21 3.5 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 25.0 bits (52), Expect = 0.28 Identities = 14/50 (28%), Positives = 21/50 (42%) Query: 5 PQDNRRIEIFPVFDASAKSPQGLLFGSSYHLGNFDECVGIEDSNDNGVSV 54 P N+ P + S + F + Y L N DE E ND+ +S+ Sbjct: 666 PSSNQSSSSTPNAEQSPSASSKDTFSNEYVLTNLDEIYKFEIENDDMLSI 715 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 21.4 bits (43), Expect = 3.5 Identities = 10/37 (27%), Positives = 17/37 (45%) Query: 38 FDECVGIEDSNDNGVSVDGQYCLATIKWQHEENKDFG 74 F E V +E + V + G + ++W E N + G Sbjct: 105 FIEAVQLETLTHSQVVIAGDFNAWHVEWGSERNSEKG 141 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.317 0.137 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,035 Number of Sequences: 2123 Number of extensions: 3408 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 75 length of database: 516,269 effective HSP length: 51 effective length of query: 24 effective length of database: 407,996 effective search space: 9791904 effective search space used: 9791904 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -