BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000859-TA|BGIBMGA000859-PA|IPR002160|Proteinase inhibitor I3, Kunitz legume (75 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0473 + 8745721-8745994,8746083-8746090,8746232-8746324,874... 28 1.1 03_06_0732 - 35788417-35788485,35788776-35788871,35788963-357891... 27 1.9 09_06_0251 - 21859484-21862162 27 2.5 04_04_0674 + 27173948-27174188,27174704-27175260,27175310-271753... 26 3.4 12_02_0869 - 23844378-23844689,23844924-23845233,23845322-238454... 25 7.8 >03_02_0473 + 8745721-8745994,8746083-8746090,8746232-8746324, 8746665-8746893,8747314-8747420,8747560-8747622, 8747883-8747983,8748996-8749090,8749330-8749350, 8749987-8750082,8750188-8750308,8750415-8750570, 8750679-8750869,8751207-8751478,8751853-8751954, 8752006-8752038,8752132-8752308,8752397-8752466, 8752512-8752585,8752667-8752908,8752983-8753129, 8753526-8753751,8753893-8753970,8754378-8754521, 8754829-8755008,8755335-8755394,8755484-8755523, 8758653-8759137 Length = 1294 Score = 27.9 bits (59), Expect = 1.1 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Query: 15 PVFDASAKSPQ--GLLFGSSYHLGNFDECVGIEDSNDNGVSVD 55 PV A+A+ Q G ++Y LG +DE ++ +DN S+D Sbjct: 466 PVLHAAARVVQEMGKSRAAAYSLGAYDEAANLQSYSDNVESLD 508 >03_06_0732 - 35788417-35788485,35788776-35788871,35788963-35789148, 35789898-35789959,35790063-35790304,35790418-35791517 Length = 584 Score = 27.1 bits (57), Expect = 1.9 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Query: 21 AKSPQGLLFGSSYHLGNFDE---CVGIEDSNDNGV 52 AK QG ++G HL + CVG+ D ++NG+ Sbjct: 344 AKPLQGPMYGVGAHLAPANSSNICVGLSDIDENGI 378 >09_06_0251 - 21859484-21862162 Length = 892 Score = 26.6 bits (56), Expect = 2.5 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query: 3 AIPQDNRRIEIFPVFDASAKSPQGLLFGSSYHLGNFDEC-VGIEDSNDNGVSVDGQY 58 A P+ N I + + +G+ F Y++ ++ EC +G ++S +GV D Y Sbjct: 210 ADPKANSPAMIHSDVAVAGFTEEGMPFAEDYYITDYSECTLGTDESPVSGVCPDKVY 266 >04_04_0674 + 27173948-27174188,27174704-27175260,27175310-27175399, 27175475-27175714,27175801-27176022,27176124-27176433, 27176528-27176847,27176906-27177021,27177133-27177227, 27177331-27177407,27177520-27177615 Length = 787 Score = 26.2 bits (55), Expect = 3.4 Identities = 10/22 (45%), Positives = 17/22 (77%) Query: 32 SYHLGNFDECVGIEDSNDNGVS 53 SY + NFD+ + +EDSN+ G++ Sbjct: 303 SYGVENFDDLLLVEDSNNPGMN 324 >12_02_0869 - 23844378-23844689,23844924-23845233,23845322-23845447, 23845522-23845727,23845832-23845964,23846045-23846208, 23846856-23846948,23847074-23847196,23847318-23847384, 23847473-23847564,23847667-23847779,23847796-23847845, 23848098-23848189 Length = 626 Score = 25.0 bits (52), Expect = 7.8 Identities = 10/45 (22%), Positives = 20/45 (44%) Query: 30 GSSYHLGNFDECVGIEDSNDNGVSVDGQYCLATIKWQHEENKDFG 74 GS ++ G F + + D ++ + IKW + + D+G Sbjct: 530 GSDHYSGPFTATTHVVVGGAGAGTSDSEFTTSNIKWSYYRDFDYG 574 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.317 0.137 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,411,031 Number of Sequences: 37544 Number of extensions: 87923 Number of successful extensions: 129 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 127 Number of HSP's gapped (non-prelim): 5 length of query: 75 length of database: 14,793,348 effective HSP length: 54 effective length of query: 21 effective length of database: 12,765,972 effective search space: 268085412 effective search space used: 268085412 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -