BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000858-TA|BGIBMGA000858-PA|IPR006621|Nose resistant to fluoxetine-4, N-terminal (1355 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 27 1.0 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 27 1.0 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 27 1.4 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 26 1.8 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 26 2.4 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 25 4.2 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 25 4.2 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 25 4.2 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 25 4.2 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 25 4.2 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 25 4.2 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 25 4.2 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 25 4.2 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 25 4.2 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 25 4.2 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 25 4.2 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 24 7.3 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 24 7.3 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 24 7.3 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 24 7.3 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 24 7.3 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 24 7.3 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 24 7.3 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 24 7.3 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 24 9.7 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 27.1 bits (57), Expect = 1.0 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 3/62 (4%) Query: 571 SRELKDENDSGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNS 629 SR ++ + S RN E + K+D + ++ ++ KLLE K RS++ +K Y KN Sbjct: 229 SRYSRERSCSRDRNREYR-KKDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLY-KNE 286 Query: 630 RE 631 RE Sbjct: 287 RE 288 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 27.1 bits (57), Expect = 1.0 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 3/62 (4%) Query: 571 SRELKDENDSGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNS 629 SR ++ + S RN E + K+D + ++ ++ KLLE K RS++ +K Y KN Sbjct: 218 SRYSRERSCSRDRNREYR-KKDRQYEKLHNEKEKLLEERTSRKRYSRSREREQKSY-KNE 275 Query: 630 RE 631 RE Sbjct: 276 RE 277 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 26.6 bits (56), Expect = 1.4 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 3/72 (4%) Query: 571 SRELKDENDSGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNS 629 SR ++ + S RN E + K+D + ++ ++ K LE K RS++ +K Y KN Sbjct: 229 SRYSRERSCSRDRNREYR-KKDRQYEKLHNEKEKFLEERTSHKRYSRSREREQKSY-KNE 286 Query: 630 RESTEKLVDGKE 641 RE + KE Sbjct: 287 REYRKYRETSKE 298 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 26.2 bits (55), Expect = 1.8 Identities = 13/43 (30%), Positives = 21/43 (48%) Query: 574 LKDENDSGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFKVER 616 L DE ++G K+K++ +E + D + ET EF R Sbjct: 142 LFDEKNAGNNKITMKSKKEQNAEEDIVDPVEENETYDEFDTIR 184 Score = 23.8 bits (49), Expect = 9.7 Identities = 12/59 (20%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 414 SSKEDQEPNKEKQSKDQLLAPSEESEDF-QTSTFWSPLTFFLTDNSKEKDDIESPPPKK 471 ++K + KE+ +++ ++ P EE+E + + T P+ L+ + + IE+ ++ Sbjct: 150 NNKITMKSKKEQNAEEDIVDPVEENETYDEFDTIRIPIVRSLSKSPPNDEGIETDSDRR 208 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 25.8 bits (54), Expect = 2.4 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Query: 1187 TSGMLWALVWWAGIDSGSTSYRYSASFAAQYAGLAPIASAMAIAWLIYAVNNGNYEEREI 1246 T M A+ W G + YS A+ + L P+A L Y+ G+ +ERE Sbjct: 412 TGEMKEAITQWQGNPISPLNDWYS--LASSWPALVPLALGFLAGELTYSQEIGDRQERES 469 Query: 1247 KQKP 1250 + P Sbjct: 470 ELVP 473 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.0 bits (52), Expect = 4.2 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Query: 580 SGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRESTEKLVD 638 S RN E + K+D + ++ +E KLLE K RS++ + Y KN RE + Sbjct: 5 SRDRNREYR-KKDRQYEKLCNEEEKLLEERTSRKRYSRSREREQNSY-KNEREYRKYRET 62 Query: 639 GKE 641 KE Sbjct: 63 SKE 65 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.0 bits (52), Expect = 4.2 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Query: 580 SGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRESTEKLVD 638 S RN E + K+D + ++ +E KLLE K RS++ + Y KN RE + Sbjct: 5 SRDRNREYR-KKDRQYEKLCNEEEKLLEERTSRKRYSRSREREQNSY-KNEREYRKYRET 62 Query: 639 GKE 641 KE Sbjct: 63 SKE 65 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.0 bits (52), Expect = 4.2 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Query: 580 SGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRESTEKLVD 638 S RN E + K+D + ++ +E KLLE K RS++ + Y KN RE + Sbjct: 5 SRDRNREYR-KKDRQYEKLCNEEEKLLEERTSRKRYSRSREREQNSY-KNEREYRKYRET 62 Query: 639 GKE 641 KE Sbjct: 63 SKE 65 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.0 bits (52), Expect = 4.2 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Query: 580 SGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRESTEKLVD 638 S RN E + K+D + ++ +E KLLE K RS++ + Y KN RE + Sbjct: 5 SRDRNREYR-KKDRQYEKLCNEEEKLLEERTSRKRYSRSREREQNSY-KNEREYRKYRET 62 Query: 639 GKE 641 KE Sbjct: 63 SKE 65 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 25.0 bits (52), Expect = 4.2 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 3/62 (4%) Query: 571 SRELKDENDSGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNS 629 SR ++ + S RN E + K+D + ++ ++ KLLE K RS++ + Y KN Sbjct: 218 SRYSRERSCSRDRNREYR-KKDRQYEKLHNEKEKLLEERTSRKRYSRSREREQNSY-KNE 275 Query: 630 RE 631 RE Sbjct: 276 RE 277 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 4.2 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 3/62 (4%) Query: 571 SRELKDENDSGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNS 629 SR ++ + S RN E + K+D + ++ ++ KLLE K RS++ + Y KN Sbjct: 229 SRYSRERSCSRDRNREYR-KKDRQYEKLHNEKEKLLEERTSRKRYSRSREREQNSY-KNE 286 Query: 630 RE 631 RE Sbjct: 287 RE 288 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 4.2 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Query: 575 KDENDSGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRE 631 ++ + S RN E + K+D + ++ ++ KLLE K RS++ +K Y KN RE Sbjct: 233 RERSCSRDRNREYR-KKDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLY-KNERE 288 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 4.2 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Query: 575 KDENDSGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRE 631 ++ + S RN E + K+D + ++ ++ KLLE K RS++ +K Y KN RE Sbjct: 233 RERSCSRDRNREYR-KKDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLY-KNERE 288 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 4.2 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Query: 575 KDENDSGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRE 631 ++ + S RN E + K+D + ++ ++ KLLE K RS++ +K Y KN RE Sbjct: 233 RERSCSRDRNREYR-KKDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLY-KNERE 288 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 4.2 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Query: 575 KDENDSGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRE 631 ++ + S RN E + K+D + ++ ++ KLLE K RS++ +K Y KN RE Sbjct: 233 RERSCSRDRNREYR-KKDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLY-KNERE 288 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 25.0 bits (52), Expect = 4.2 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Query: 575 KDENDSGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRE 631 ++ + S RN E + K+D + ++ ++ KLLE K RS++ +K Y KN RE Sbjct: 222 RERSCSRDRNREYR-KKDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLY-KNERE 277 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 7.3 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Query: 580 SGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRESTE 634 S RN E + K+D + ++ ++ K LE K RS++ +K Y KN RE E Sbjct: 5 SRDRNREYR-KKDRQYEKLYNEKEKFLEEKTSRKRYSRSREREQKSY-KNEREYRE 58 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 7.3 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Query: 580 SGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRESTE 634 S RN E + K+D + ++ ++ K LE K RS++ +K Y KN RE E Sbjct: 5 SRDRNREYR-KKDRQYEKLYNEKEKFLEEKTSRKRYSRSREREQKSY-KNEREYRE 58 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 7.3 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Query: 580 SGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRESTE 634 S RN E + K+D + ++ ++ K LE K RS++ +K Y KN RE E Sbjct: 5 SRDRNREYR-KKDRQYEKLYNEKEKFLEEKTSRKRYSRSREREQKSY-KNEREYRE 58 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 7.3 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Query: 580 SGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRESTE 634 S RN E + K+D + ++ ++ K LE K RS++ +K Y KN RE E Sbjct: 5 SRDRNREYR-KKDRQYEKLYNEKEKFLEEKTSRKRYSRSREREQKSY-KNEREYRE 58 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.2 bits (50), Expect = 7.3 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Query: 580 SGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRE 631 S RN E + K+D + ++ ++ KLLE K RS++ +K Y KN RE Sbjct: 5 SRDRNREYR-KKDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLY-KNERE 55 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.2 bits (50), Expect = 7.3 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Query: 580 SGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRE 631 S RN E + K+D + ++ ++ KLLE K RS++ +K Y KN RE Sbjct: 5 SRDRNREYR-KKDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLY-KNERE 55 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.2 bits (50), Expect = 7.3 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Query: 580 SGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRE 631 S RN E + K+D + ++ ++ KLLE K RS++ +K Y KN RE Sbjct: 5 SRDRNREYR-KKDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLY-KNERE 55 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.2 bits (50), Expect = 7.3 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Query: 580 SGGRNFEKKTKEDSKKQETLGDEYKLLETMKEFK-VERSKKCTEKQYIKNSRE 631 S RN E + K+D + ++ ++ KLLE K RS++ +K Y KN RE Sbjct: 5 SRDRNREYR-KKDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLY-KNERE 55 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.8 bits (49), Expect = 9.7 Identities = 13/44 (29%), Positives = 20/44 (45%) Query: 603 YKLLETMKEFKVERSKKCTEKQYIKNSRESTEKLVDGKEVKSGS 646 Y ++ +K F +K +NSR + E L DG+ K S Sbjct: 444 YFIVRALKPFIPAVTKSLASLTDAENSRRAMENLGDGRNNKEDS 487 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.131 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 324,025 Number of Sequences: 429 Number of extensions: 13216 Number of successful extensions: 57 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 22 Number of HSP's that attempted gapping in prelim test: 52 Number of HSP's gapped (non-prelim): 29 length of query: 1355 length of database: 140,377 effective HSP length: 66 effective length of query: 1289 effective length of database: 112,063 effective search space: 144449207 effective search space used: 144449207 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -