Silkworm BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000857-TA|BGIBMGA000857-PA|undefined
         (63 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_33446| Best HMM Match : 7tm_1 (HMM E-Value=6.7e-26)                 26   5.0  

>SB_33446| Best HMM Match : 7tm_1 (HMM E-Value=6.7e-26)
          Length = 291

 Score = 25.8 bits (54), Expect = 5.0
 Identities = 12/32 (37%), Positives = 16/32 (50%)

Query: 31 AFQNRSIRGKSLRTAACPYRSDACASDTRSIP 62
          AFQN  +  +S++     YR D CA     IP
Sbjct: 39 AFQNPILMARSIKFGYMEYRYDLCACYNSLIP 70


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.321    0.124    0.371 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,809,991
Number of Sequences: 59808
Number of extensions: 46504
Number of successful extensions: 102
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 101
Number of HSP's gapped (non-prelim): 1
length of query: 63
length of database: 16,821,457
effective HSP length: 42
effective length of query: 21
effective length of database: 14,309,521
effective search space: 300499941
effective search space used: 300499941
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 52 (25.0 bits)