BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000857-TA|BGIBMGA000857-PA|undefined (63 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33446| Best HMM Match : 7tm_1 (HMM E-Value=6.7e-26) 26 5.0 >SB_33446| Best HMM Match : 7tm_1 (HMM E-Value=6.7e-26) Length = 291 Score = 25.8 bits (54), Expect = 5.0 Identities = 12/32 (37%), Positives = 16/32 (50%) Query: 31 AFQNRSIRGKSLRTAACPYRSDACASDTRSIP 62 AFQN + +S++ YR D CA IP Sbjct: 39 AFQNPILMARSIKFGYMEYRYDLCACYNSLIP 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.321 0.124 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,809,991 Number of Sequences: 59808 Number of extensions: 46504 Number of successful extensions: 102 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 101 Number of HSP's gapped (non-prelim): 1 length of query: 63 length of database: 16,821,457 effective HSP length: 42 effective length of query: 21 effective length of database: 14,309,521 effective search space: 300499941 effective search space used: 300499941 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -