BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000857-TA|BGIBMGA000857-PA|undefined (63 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23139-9|AAN65327.1| 632|Caenorhabditis elegans Biotin protein ... 28 0.71 U23139-8|AAK31491.2| 1051|Caenorhabditis elegans Biotin protein ... 28 0.71 AY601656-1|AAS98221.1| 632|Caenorhabditis elegans biotin protei... 28 0.71 AF100669-9|AAK39269.1| 605|Caenorhabditis elegans Dipeptidyl pe... 27 1.6 Z75537-1|CAA99834.1| 455|Caenorhabditis elegans Hypothetical pr... 25 5.0 AF125962-1|AAD14741.1| 341|Caenorhabditis elegans Seven tm rece... 25 8.7 >U23139-9|AAN65327.1| 632|Caenorhabditis elegans Biotin protein ligase protein 1,isoform b protein. Length = 632 Score = 28.3 bits (60), Expect = 0.71 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Query: 18 TAMEAKTVQPMVLAFQNRSIRGKSLRTAACPYRSDACASDTRSIP 62 T ++V P +QNRS+RG +AA P+R S R +P Sbjct: 18 TGDRGRSVSPSFEYYQNRSLRG--FTSAANPHRVATRNSTVRQVP 60 >U23139-8|AAK31491.2| 1051|Caenorhabditis elegans Biotin protein ligase protein 1,isoform a protein. Length = 1051 Score = 28.3 bits (60), Expect = 0.71 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Query: 10 RYLSTVEPTAMEAKTVQPMVLAFQNRSIRGKSLRTAACPYRSDACASDTRSIP 62 R S + ++V P +QNRS+RG +AA P+R S R +P Sbjct: 429 RRFSAFSTESDRGRSVSPSFEYYQNRSLRG--FTSAANPHRVATRNSTVRQVP 479 >AY601656-1|AAS98221.1| 632|Caenorhabditis elegans biotin protein ligase, holocarboxylasesynthetase (70.9 kD) alternative variant b protein. Length = 632 Score = 28.3 bits (60), Expect = 0.71 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Query: 18 TAMEAKTVQPMVLAFQNRSIRGKSLRTAACPYRSDACASDTRSIP 62 T ++V P +QNRS+RG +AA P+R S R +P Sbjct: 18 TGDRGRSVSPSFEYYQNRSLRG--FTSAANPHRVATRNSTVRQVP 60 >AF100669-9|AAK39269.1| 605|Caenorhabditis elegans Dipeptidyl peptidase four (iv)family protein 7, isoform a protein. Length = 605 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Query: 9 ARYLSTVEPTAMEAKTVQPMVLAFQNRS 36 A +L VEP + ++ V PM++ +N+S Sbjct: 518 AEFLKDVEPVSHASEIVTPMLIVLENKS 545 >Z75537-1|CAA99834.1| 455|Caenorhabditis elegans Hypothetical protein F18E2.1 protein. Length = 455 Score = 25.4 bits (53), Expect = 5.0 Identities = 12/47 (25%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Query: 1 MLMSYQWMARYLSTVEPTAMEAKTVQPMVLAFQNRSIRGKSLRTAAC 47 ++ Y W+ R L+T A + P + FQ+R ++ +A C Sbjct: 243 VMTQYDWLKRDLTT----ANSNRAAHPWIFTFQHRPFYCSNVNSAEC 285 >AF125962-1|AAD14741.1| 341|Caenorhabditis elegans Seven tm receptor protein 113 protein. Length = 341 Score = 24.6 bits (51), Expect = 8.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Query: 25 VQPMVLAFQNRSIRGKSLRTAACPYRSDA 53 + P+VL F R R LR C YRS++ Sbjct: 296 IDPVVLIFIIRDFRQTILRPFRCFYRSNS 324 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.321 0.124 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,294,701 Number of Sequences: 27539 Number of extensions: 30034 Number of successful extensions: 48 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 46 Number of HSP's gapped (non-prelim): 6 length of query: 63 length of database: 12,573,161 effective HSP length: 43 effective length of query: 20 effective length of database: 11,388,984 effective search space: 227779680 effective search space used: 227779680 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -