BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000857-TA|BGIBMGA000857-PA|undefined (63 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-1162|AAN10598.1| 2922|Drosophila melanogaster CG11321-P... 26 7.5 >AE014134-1162|AAN10598.1| 2922|Drosophila melanogaster CG11321-PB, isoform B protein. Length = 2922 Score = 25.8 bits (54), Expect = 7.5 Identities = 12/44 (27%), Positives = 22/44 (50%) Query: 17 PTAMEAKTVQPMVLAFQNRSIRGKSLRTAACPYRSDACASDTRS 60 P ++ K + A + +++ K L AA +SD ASD ++ Sbjct: 1611 PNNIDQKVNESKTAAKETEAVKDKDLSAAASNIQSDVTASDPKT 1654 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.321 0.124 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,527,786 Number of Sequences: 52641 Number of extensions: 58313 Number of successful extensions: 136 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 135 Number of HSP's gapped (non-prelim): 1 length of query: 63 length of database: 24,830,863 effective HSP length: 43 effective length of query: 20 effective length of database: 22,567,300 effective search space: 451346000 effective search space used: 451346000 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -