GeneModel BLAST Result against fruitfly

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000857-TA|BGIBMGA000857-PA|undefined
         (63 letters)

Database: fruitfly 
           52,641 sequences; 24,830,863 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014134-1162|AAN10598.1| 2922|Drosophila melanogaster CG11321-P...    26   7.5  

>AE014134-1162|AAN10598.1| 2922|Drosophila melanogaster CG11321-PB,
            isoform B protein.
          Length = 2922

 Score = 25.8 bits (54), Expect = 7.5
 Identities = 12/44 (27%), Positives = 22/44 (50%)

Query: 17   PTAMEAKTVQPMVLAFQNRSIRGKSLRTAACPYRSDACASDTRS 60
            P  ++ K  +    A +  +++ K L  AA   +SD  ASD ++
Sbjct: 1611 PNNIDQKVNESKTAAKETEAVKDKDLSAAASNIQSDVTASDPKT 1654


  Database: fruitfly
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 24,830,863
  Number of sequences in database:  52,641
  
Lambda     K      H
   0.321    0.124    0.371 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,527,786
Number of Sequences: 52641
Number of extensions: 58313
Number of successful extensions: 136
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 135
Number of HSP's gapped (non-prelim): 1
length of query: 63
length of database: 24,830,863
effective HSP length: 43
effective length of query: 20
effective length of database: 22,567,300
effective search space: 451346000
effective search space used: 451346000
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 53 (25.4 bits)