BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000853-TA|BGIBMGA000853-PA|IPR011051|Cupin, RmlC-type, IPR003101|Coactivator CBP, KIX, IPR001487|Bromodomain, IPR010303|Protein of unknown function DUF902, CREBbp, IPR009255|Transcriptional coactivation, IPR000433|Zinc finger, ZZ-type, IPR000197|Zinc finger, TAZ-type, IPR001965|Zinc finger, PHD-type, IPR006089|Acyl-CoA dehydrogenase (1573 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 27 1.0 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 7.2 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 27.1 bits (57), Expect = 1.0 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 1/63 (1%) Query: 305 NNLVGPPGPSP-NQMGQTSNGSVGSVGAPGMSPFGSLTSPAPHYAQTNGPAPLASPTHQH 363 N+L GP P+ + GSVG VG S G+ + N P + S + Q Sbjct: 133 NSLTGPVRPAACTPDSRVGYGSVGLVGGDPASSPGAAAGRTGNSLSWNNPCSINSTSSQP 192 Query: 364 IDT 366 + T Sbjct: 193 VGT 195 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 24.2 bits (50), Expect = 7.2 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 1208 QSIQRCIQSLVHACQCRDANCRLPSCQKMKRVVTHTKICKRKTKGDCP-ICKQL 1260 Q +R + VH + +C +P C K+ +H K R G+ P +C L Sbjct: 297 QEAERLGPAGVHLRKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWL 350 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.417 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 282,761 Number of Sequences: 317 Number of extensions: 11698 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 25 Number of HSP's gapped (non-prelim): 2 length of query: 1573 length of database: 114,650 effective HSP length: 66 effective length of query: 1507 effective length of database: 93,728 effective search space: 141248096 effective search space used: 141248096 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -