Silkworm BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000852-TA|BGIBMGA000852-PA|undefined
         (342 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             22   8.9  

>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.8 bits (44), Expect = 8.9
 Identities = 15/51 (29%), Positives = 21/51 (41%), Gaps = 1/51 (1%)

Query: 51   EQPGVPGPKPPAQGLGPGQMAPQQQLNGDDPAAAMHRQINNHLLQG-NKSG 100
            +QP    P+P  Q     Q  PQQQ       + +  Q+      G N+SG
Sbjct: 1522 QQPQQQQPQPQQQQQQQQQQQPQQQQKEYGAVSGLVVQLQRGYNSGNNRSG 1572


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.313    0.132    0.407 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 85,536
Number of Sequences: 429
Number of extensions: 3132
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 342
length of database: 140,377
effective HSP length: 58
effective length of query: 284
effective length of database: 115,495
effective search space: 32800580
effective search space used: 32800580
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 44 (21.8 bits)