BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000852-TA|BGIBMGA000852-PA|undefined (342 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 3.2 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 22 5.6 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 22 5.6 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 9.8 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/23 (39%), Positives = 10/23 (43%) Query: 190 NVNKQLPTLMGNSHHGTHHPHAQ 212 N N + HH HH HAQ Sbjct: 311 NNNNAATNNQNHHHHAGHHIHAQ 333 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/32 (34%), Positives = 15/32 (46%) Query: 53 PGVPGPKPPAQGLGPGQMAPQQQLNGDDPAAA 84 P V G + + G G G ++PQ Q P A Sbjct: 89 PTVSGSEMSSPGAGSGNLSPQIQTQVARPPPA 120 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/32 (34%), Positives = 15/32 (46%) Query: 53 PGVPGPKPPAQGLGPGQMAPQQQLNGDDPAAA 84 P V G + + G G G ++PQ Q P A Sbjct: 89 PTVSGSEMSSPGAGSGNLSPQIQTQVARPPPA 120 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Query: 140 MPNTSHPNQLHSTMPMSSIQGGMNVT 165 + N N L S+ P SSI GG++ + Sbjct: 73 LTNNVPSNGLSSSGPFSSIGGGISAS 98 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.132 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,288 Number of Sequences: 317 Number of extensions: 3099 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 4 length of query: 342 length of database: 114,650 effective HSP length: 57 effective length of query: 285 effective length of database: 96,581 effective search space: 27525585 effective search space used: 27525585 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -