BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000851-TA|BGIBMGA000851-PA|IPR009080|Aminoacyl-tRNA synthetase, class 1a, anticodon-binding, IPR001278|Arginyl-tRNA synthetase, class Ic, IPR008909|DALR anticodon binding (365 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 24 2.4 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 24 2.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 4.1 DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 23 5.4 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 23 5.4 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 23.8 bits (49), Expect = 2.4 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Query: 19 FSDI-EQGKISLENWKKIRNVTVHELENVYQ--RLGITFDAFHWESDYNG 65 F+DI E+ + S ++ + + +N+ Q R ITF WE YNG Sbjct: 391 FNDIFEKDQASFLERERFLGIINNIFKNMSQIEREAITFQYTDWEEVYNG 440 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 23.8 bits (49), Expect = 2.4 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Query: 19 FSDI-EQGKISLENWKKIRNVTVHELENVYQ--RLGITFDAFHWESDYNG 65 F+DI E+ + S ++ + + +N+ Q R ITF WE YNG Sbjct: 391 FNDIFEKDQASFLERERFLGIINNIFKNMSQIEREAITFQYTDWEEVYNG 440 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.0 bits (47), Expect = 4.1 Identities = 12/31 (38%), Positives = 16/31 (51%) Query: 215 GTTAVVINDLKQRRQRDYEFNWDRALQSEGD 245 GTT + L++RRQ D E DR E + Sbjct: 257 GTTTIPTRRLRKRRQNDGEGADDRDDDEENE 287 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 22.6 bits (46), Expect = 5.4 Identities = 7/18 (38%), Positives = 13/18 (72%) Query: 139 DHFSSVFEIVKQFNKKCT 156 +H ++F+I+K N+K T Sbjct: 57 NHIQNIFKIIKSTNEKIT 74 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 22.6 bits (46), Expect = 5.4 Identities = 7/18 (38%), Positives = 13/18 (72%) Query: 139 DHFSSVFEIVKQFNKKCT 156 +H ++F+I+K N+K T Sbjct: 40 NHIQNIFKIIKSTNEKIT 57 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.134 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,227 Number of Sequences: 429 Number of extensions: 3796 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 5 length of query: 365 length of database: 140,377 effective HSP length: 59 effective length of query: 306 effective length of database: 115,066 effective search space: 35210196 effective search space used: 35210196 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -