SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000850-TA|BGIBMGA000850-PA|IPR001478|PDZ/DHR/GLGF
         (433 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1...    27   6.8  

>SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 574

 Score = 26.6 bits (56), Expect = 6.8
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 255 ANSPPYSPAKGPGKVYASVAEMKR--SRAKLWS--KCPGTL----RREFHSTPDLAAELA 306
           A +PP +PA  P    AS+AE+ +   RA L +  +  G +     R+  ++P +A+   
Sbjct: 473 APAPPPAPAPAPAAPVASIAELPQQDGRANLMASIRASGGMDLLKSRKVSASPSVASTKT 532

Query: 307 PHPP 310
            +PP
Sbjct: 533 SNPP 536


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.315    0.129    0.380 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,369,935
Number of Sequences: 5004
Number of extensions: 39886
Number of successful extensions: 95
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 95
Number of HSP's gapped (non-prelim): 1
length of query: 433
length of database: 2,362,478
effective HSP length: 75
effective length of query: 358
effective length of database: 1,987,178
effective search space: 711409724
effective search space used: 711409724
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 55 (26.2 bits)

- SilkBase 1999-2023 -