BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000850-TA|BGIBMGA000850-PA|IPR001478|PDZ/DHR/GLGF (433 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 27 6.8 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 26.6 bits (56), Expect = 6.8 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 8/64 (12%) Query: 255 ANSPPYSPAKGPGKVYASVAEMKR--SRAKLWS--KCPGTL----RREFHSTPDLAAELA 306 A +PP +PA P AS+AE+ + RA L + + G + R+ ++P +A+ Sbjct: 473 APAPPPAPAPAPAAPVASIAELPQQDGRANLMASIRASGGMDLLKSRKVSASPSVASTKT 532 Query: 307 PHPP 310 +PP Sbjct: 533 SNPP 536 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.315 0.129 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,369,935 Number of Sequences: 5004 Number of extensions: 39886 Number of successful extensions: 95 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 95 Number of HSP's gapped (non-prelim): 1 length of query: 433 length of database: 2,362,478 effective HSP length: 75 effective length of query: 358 effective length of database: 1,987,178 effective search space: 711409724 effective search space used: 711409724 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -