BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000850-TA|BGIBMGA000850-PA|IPR001478|PDZ/DHR/GLGF (433 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 25 5.3 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 24.6 bits (51), Expect = 5.3 Identities = 18/86 (20%), Positives = 32/86 (37%) Query: 240 GGNNAMMIRSAFQGGANSPPYSPAKGPGKVYASVAEMKRSRAKLWSKCPGTLRREFHSTP 299 GG + G +S P P G +S S + + P ++ + Sbjct: 140 GGGSGGNAHDHLADGLHSIPSPPITVSGSDMSSPGAPTGSSSPQITPRPTPVKSPYEWMK 199 Query: 300 DLAAELAPHPPRTRSTDDVHVHYDDE 325 + + P+P +TR+ D V Y D+ Sbjct: 200 KQSYQSQPNPGKTRTKDKYRVVYTDQ 225 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.315 0.129 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 338,504 Number of Sequences: 2123 Number of extensions: 10508 Number of successful extensions: 14 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 1 length of query: 433 length of database: 516,269 effective HSP length: 66 effective length of query: 367 effective length of database: 376,151 effective search space: 138047417 effective search space used: 138047417 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -