BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000849-TA|BGIBMGA000849-PA|IPR002110|Ankyrin, IPR001452|Src homology-3, IPR011511|Variant SH3 (523 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 26 0.56 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 22 9.1 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 26.2 bits (55), Expect = 0.56 Identities = 15/49 (30%), Positives = 21/49 (42%) Query: 453 DDGLLEGCVRGSGAAGLFPAHCVQEVRLRQNNVHLHQVLASGPIHHSRV 501 DDG+ G + G AGL+ H L+ + H A P H + V Sbjct: 9 DDGIHPGYMDGGAGAGLYEPHVAHRPGLQGLHHSPHLNHAMHPYHANHV 57 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 22.2 bits (45), Expect = 9.1 Identities = 9/28 (32%), Positives = 12/28 (42%) Query: 410 NSDTTTCSLQPSSTAVCLQPYEGAAPGH 437 N D P+ T+V + Y PGH Sbjct: 303 NDDAFNSVATPTPTSVMTELYPSPVPGH 330 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.134 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,901 Number of Sequences: 317 Number of extensions: 4629 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 2 length of query: 523 length of database: 114,650 effective HSP length: 60 effective length of query: 463 effective length of database: 95,630 effective search space: 44276690 effective search space used: 44276690 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -