BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000847-TA|BGIBMGA000847-PA|undefined (104 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03970.3 68416.m00418 expressed protein 31 0.11 At3g03970.2 68416.m00417 expressed protein 31 0.11 At3g03970.1 68416.m00416 expressed protein 31 0.11 At1g04210.1 68414.m00411 leucine-rich repeat family protein / pr... 31 0.11 At3g17850.1 68416.m02275 protein kinase, putative similar to IRE... 31 0.19 At2g31210.1 68415.m03811 basic helix-loop-helix (bHLH) family pr... 30 0.34 At1g22000.1 68414.m02752 F-box family protein contains F-box dom... 29 0.45 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 29 0.59 At5g07710.1 68418.m00884 exonuclease family protein contains exo... 28 1.0 At1g71840.1 68414.m08302 transducin family protein / WD-40 repea... 28 1.4 At3g19240.1 68416.m02441 expressed protein 27 1.8 At4g38910.1 68417.m05514 expressed protein 27 2.4 At2g27440.1 68415.m03316 rac GTPase activating protein, putative... 27 2.4 At5g52950.1 68418.m06570 expressed protein ; expression supporte... 27 3.1 At5g15140.1 68418.m01774 aldose 1-epimerase family protein simil... 27 3.1 At4g31880.1 68417.m04531 expressed protein 27 3.1 At1g23380.2 68414.m02924 homeobox transcription factor (KNAT6) n... 27 3.1 At1g23380.1 68414.m02925 homeobox transcription factor (KNAT6) n... 27 3.1 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 26 4.2 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 26 4.2 At5g42740.1 68418.m05205 glucose-6-phosphate isomerase, cytosoli... 26 4.2 At4g26630.1 68417.m03837 expressed protein 26 5.5 At2g22795.1 68415.m02704 expressed protein 26 5.5 At1g65890.1 68414.m07477 acyl-activating enzyme 12 (AAE12) simil... 26 5.5 At1g21530.1 68414.m02693 AMP-binding protein, putative strong si... 26 5.5 At5g55660.1 68418.m06940 expressed protein similar to unknown pr... 25 7.3 At5g01980.1 68418.m00117 zinc finger (C3HC4-type RING finger) fa... 25 7.3 At3g56720.1 68416.m06309 expressed protein 25 7.3 At1g77590.1 68414.m09034 long-chain-fatty-acid--CoA ligase famil... 25 7.3 At5g53930.1 68418.m06710 expressed protein 25 9.6 At5g35160.1 68418.m04167 endomembrane protein 70, putative p76, ... 25 9.6 At2g44250.1 68415.m05506 expressed protein contains Pfam profi... 25 9.6 At1g76810.1 68414.m08938 eukaryotic translation initiation facto... 25 9.6 At1g10320.1 68414.m01162 U2 snRNP auxiliary factor-related simil... 25 9.6 >At3g03970.3 68416.m00418 expressed protein Length = 554 Score = 31.5 bits (68), Expect = 0.11 Identities = 13/30 (43%), Positives = 19/30 (63%) Query: 49 KKRKTSESCDKSDRHGVAEDGTTVVTDYRK 78 KKR++ + C K RHG A+D T + D R+ Sbjct: 429 KKRQSGDICSKHHRHGFAQDPFTELLDNRQ 458 >At3g03970.2 68416.m00417 expressed protein Length = 554 Score = 31.5 bits (68), Expect = 0.11 Identities = 13/30 (43%), Positives = 19/30 (63%) Query: 49 KKRKTSESCDKSDRHGVAEDGTTVVTDYRK 78 KKR++ + C K RHG A+D T + D R+ Sbjct: 429 KKRQSGDICSKHHRHGFAQDPFTELLDNRQ 458 >At3g03970.1 68416.m00416 expressed protein Length = 554 Score = 31.5 bits (68), Expect = 0.11 Identities = 13/30 (43%), Positives = 19/30 (63%) Query: 49 KKRKTSESCDKSDRHGVAEDGTTVVTDYRK 78 KKR++ + C K RHG A+D T + D R+ Sbjct: 429 KKRQSGDICSKHHRHGFAQDPFTELLDNRQ 458 >At1g04210.1 68414.m00411 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1112 Score = 31.5 bits (68), Expect = 0.11 Identities = 18/69 (26%), Positives = 34/69 (49%), Gaps = 2/69 (2%) Query: 29 DSKKCSDIVFDD-ESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPSDESEVDD 87 +S +D+V D+ + V+ +R ESC+ + D V DY S+ + ++ Sbjct: 417 ESSLKADVVSDNSQCVETQLTSERDNYESCEIKTSSPSSGDAPGTV-DYNSSSERKKPNN 475 Query: 88 RKKRCIDRY 96 + KRC ++Y Sbjct: 476 KSKRCSEKY 484 >At3g17850.1 68416.m02275 protein kinase, putative similar to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783; contains protein kinase domain Pfam:PF00069 Length = 1296 Score = 30.7 bits (66), Expect = 0.19 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Query: 27 HRDSKKCSDIVFDDESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVV--TDYRKPSDESE 84 HRD K + ++ D +KL+ F K D G A GT+++ + R + E + Sbjct: 1003 HRDLKPDNLLIAHDGHIKLTDFGLSKVGLINSTDDLAGPAVSGTSLLDEEESRLAASEEQ 1062 Query: 85 VDDRKKR 91 ++ RKKR Sbjct: 1063 LERRKKR 1069 >At2g31210.1 68415.m03811 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain; PMID: 12679534 Length = 428 Score = 29.9 bits (64), Expect = 0.34 Identities = 14/48 (29%), Positives = 24/48 (50%) Query: 56 SCDKSDRHGVAEDGTTVVTDYRKPSDESEVDDRKKRCIDRYDSSESSD 103 S K DR + +DG + + R+ E + +KRC R+ ++E D Sbjct: 239 SPSKGDRASILQDGIDYINELRRRVSELKYLVERKRCGGRHKNNEVDD 286 >At1g22000.1 68414.m02752 F-box family protein contains F-box domain Pfam:PF00646 Length = 727 Score = 29.5 bits (63), Expect = 0.45 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Query: 30 SKKCSDIVFDDESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPSDESEVDDRK 89 +KKCS V+ D S KL K S S KS G D +V + DE+ Sbjct: 453 TKKCSAYVYKDPSTKLEVLKSELES-SMAKSRALGDRNDEMSVELEEHATRDENAERSYS 511 Query: 90 KRCI 93 KR + Sbjct: 512 KRSL 515 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 29.1 bits (62), Expect = 0.59 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 2/81 (2%) Query: 12 LKQMNNLTFTATDKGHRDSKKCSDIVFDDESVKLSYFKKRKTSESCDKSDRHGVAEDGTT 71 LK + L T + + SD+ D ++K + KRK ++ SD H V+++ Sbjct: 1584 LKTSDTLIQTGYASDCQQKRNPSDL--DSSNLKRMVYVKRKANQLVAASDIHDVSQNQIP 1641 Query: 72 VVTDYRKPSDESEVDDRKKRC 92 Y K S V + + RC Sbjct: 1642 SSDGYFKRSKNQLVRNSESRC 1662 >At5g07710.1 68418.m00884 exonuclease family protein contains exonuclease domain, Pfam:PF00929 Length = 468 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/50 (26%), Positives = 24/50 (48%) Query: 31 KKCSDIVFDDESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPS 80 K C+ ++F + S+ ++ + E+ R + +G TV T R PS Sbjct: 173 KYCATVLFLESSLPYAHVDNSVSPETISSRRRIDASREGNTVTTSVRLPS 222 >At1g71840.1 68414.m08302 transducin family protein / WD-40 repeat family protein contains Pfam profile:PF00560 Leucine Rich Repeat (4 copies); Pfam profile:PF00069 Eukaryotic protein kinase domain; Pfam profile:PF00400 WD domain, G-beta repeat (7 copies) Length = 407 Score = 27.9 bits (59), Expect = 1.4 Identities = 13/41 (31%), Positives = 22/41 (53%) Query: 1 MADGSPEDRAGLKQMNNLTFTATDKGHRDSKKCSDIVFDDE 41 +A G +D+A L ++ N + A GH+DS C +D + Sbjct: 86 VATGGGDDKAFLWKIGNGDWAAELPGHKDSVSCLAFSYDGQ 126 >At3g19240.1 68416.m02441 expressed protein Length = 648 Score = 27.5 bits (58), Expect = 1.8 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Query: 53 TSESCDKSDRHGVAEDGTTVVTDYRKPSDESEVDDRKKRCIDRYDSSESSD 103 TS+S + DR ++E T +DY + DE + DD KK+ + SD Sbjct: 3 TSQS--REDR--ISESDTESDSDYYEEEDEDQYDDAKKQGSSSVSGTRPSD 49 >At4g38910.1 68417.m05514 expressed protein Length = 445 Score = 27.1 bits (57), Expect = 2.4 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Query: 3 DGSPEDRAGLKQM--NNLTFTATDKGHRDSKKCSDIVFDDESVKL 45 DGS E ++G K+ NN A D KKC + +F++++ KL Sbjct: 384 DGSAE-KSGNKETKDNNCESLAIVVNSADQKKCMEKIFENKTAKL 427 >At2g27440.1 68415.m03316 rac GTPase activating protein, putative similar to rac GTPase activating protein 3 [Lotus japonicus] GI:3695063; contains Pfam profiles PF00620: RhoGAP domain, PF00786: P21-Rho-binding domain Length = 368 Score = 27.1 bits (57), Expect = 2.4 Identities = 13/52 (25%), Positives = 25/52 (48%) Query: 40 DESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPSDESEVDDRKKR 91 ++ V++ ++ + E D D + T++ D KPS +DRKK+ Sbjct: 315 NQEVEIYVLEEVEEEEGEDVDDLDNEESERITLLADEHKPSSAVNANDRKKQ 366 >At5g52950.1 68418.m06570 expressed protein ; expression supported by MPSS Length = 945 Score = 26.6 bits (56), Expect = 3.1 Identities = 10/37 (27%), Positives = 19/37 (51%) Query: 33 CSDIVFDDESVKLSYFKKRKTSESCDKSDRHGVAEDG 69 C + +FDD ++LS+ + E C+ + G + G Sbjct: 205 CVNELFDDRDIQLSWIDVKSGDERCELGLKSGFFDSG 241 >At5g15140.1 68418.m01774 aldose 1-epimerase family protein similar to SP|P05149 Aldose 1-epimerase precursor (EC 5.1.3.3) (Mutarotase) from Acinetobacter calcoaceticus; contains Pfam profile PF01263 Aldose 1-epimerase Length = 490 Score = 26.6 bits (56), Expect = 3.1 Identities = 22/74 (29%), Positives = 29/74 (39%), Gaps = 3/74 (4%) Query: 24 DKGHRDSKKCSDIVFDDESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPSDES 83 +K H D KK DD+ K KK+ D SD +D D DE Sbjct: 94 EKKHVDKKKSGGHDKDDDDEKKHKDKKKDGHNDDDDSDDDTDDDDDD---DDDDDDDDEV 150 Query: 84 EVDDRKKRCIDRYD 97 + DD +K I Y+ Sbjct: 151 DGDDNEKEKIGLYE 164 >At4g31880.1 68417.m04531 expressed protein Length = 873 Score = 26.6 bits (56), Expect = 3.1 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 9/82 (10%) Query: 15 MNNLTFTATDKGHRDSKKCSDIVFDDESVKLSYFKKRK--------TSESCDKSDRHGVA 66 M+ + + + +KK +++DD ++ Y K +K S+ + +D+ G Sbjct: 619 MDQAYYKGVVESYDAAKKKHLVIYDDGDQEILYLKNQKWSPLDESELSQDEEAADQTGQE 678 Query: 67 EDGTTV-VTDYRKPSDESEVDD 87 ED +TV +T K +S++D+ Sbjct: 679 EDASTVPLTKKAKTGKQSKMDN 700 >At1g23380.2 68414.m02924 homeobox transcription factor (KNAT6) nearly identical to homeodomain transcription factor KNAT6 (KNAT6L) GI:15991302 [Arabidopsis thaliana], homeodomain transcription factor KNAT6 (KNAT6S) [Arabidopsis thaliana] GI:15991300 Length = 326 Score = 26.6 bits (56), Expect = 3.1 Identities = 14/58 (24%), Positives = 25/58 (43%) Query: 38 FDDESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPSDESEVDDRKKRCIDR 95 FD+ + L+ + + + GV+EDG + D +D ++RC DR Sbjct: 165 FDEATCFLNKIEMQLRNLCTGVESARGVSEDGVISSDEELSGGDHEVAEDGRQRCEDR 222 >At1g23380.1 68414.m02925 homeobox transcription factor (KNAT6) nearly identical to homeodomain transcription factor KNAT6 (KNAT6L) GI:15991302 [Arabidopsis thaliana], homeodomain transcription factor KNAT6 (KNAT6S) [Arabidopsis thaliana] GI:15991300 Length = 327 Score = 26.6 bits (56), Expect = 3.1 Identities = 14/58 (24%), Positives = 25/58 (43%) Query: 38 FDDESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPSDESEVDDRKKRCIDR 95 FD+ + L+ + + + GV+EDG + D +D ++RC DR Sbjct: 166 FDEATCFLNKIEMQLRNLCTGVESARGVSEDGVISSDEELSGGDHEVAEDGRQRCEDR 223 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 26.2 bits (55), Expect = 4.2 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 7/56 (12%) Query: 48 FKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPS-DESEVDDRKKRCIDRYDSSESS 102 ++KR S S D+ +RH + D+R+ + S D K+R RYD+ S Sbjct: 158 YRKRSRSRSYDRRERHEEKD------RDHRRRTRSRSASPDEKRRVRGRYDNESRS 207 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 26.2 bits (55), Expect = 4.2 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 7/56 (12%) Query: 48 FKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPS-DESEVDDRKKRCIDRYDSSESS 102 ++KR S S D+ +RH + D+R+ + S D K+R RYD+ S Sbjct: 158 YRKRSRSRSYDRRERHEEKD------RDHRRRTRSRSASPDEKRRVRGRYDNESRS 207 >At5g42740.1 68418.m05205 glucose-6-phosphate isomerase, cytosolic (PGIC) identical to SP|P34795 Glucose-6-phosphate isomerase, cytosolic (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) {Arabidopsis thaliana}; contains Pfam profile PF00342: glucose-6-phosphate isomerase Length = 560 Score = 26.2 bits (55), Expect = 4.2 Identities = 9/31 (29%), Positives = 19/31 (61%) Query: 29 DSKKCSDIVFDDESVKLSYFKKRKTSESCDK 59 D+ +C ++ + + + L Y ++R T E+ DK Sbjct: 35 DANRCQSMMMEFDGLLLDYSRQRATVETMDK 65 >At4g26630.1 68417.m03837 expressed protein Length = 763 Score = 25.8 bits (54), Expect = 5.5 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Query: 40 DESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPSDESEVDDRKKRCIDRYDSS 99 D K+ + K E+ + ++ E+ T V + DES+V+D K+ D D+ Sbjct: 195 DMDEKVENGDENKQVENVEGKEKEDKEENKTKEVEAAKAEVDESKVEDEKEGSEDENDNE 254 Query: 100 --ESSD 103 ES D Sbjct: 255 KVESKD 260 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 25.8 bits (54), Expect = 5.5 Identities = 15/64 (23%), Positives = 34/64 (53%), Gaps = 1/64 (1%) Query: 26 GHRDSKKCSDIVFDDESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPSDESEV 85 G + +K S+ + +E S +++K S ++S+ ++G + + ++ESEV Sbjct: 107 GEENKEKESEGIVSNEDSN-SEIEEKKDSGGVEESEVEEKRDNGGGTEENEKSGTEESEV 165 Query: 86 DDRK 89 ++RK Sbjct: 166 EERK 169 >At1g65890.1 68414.m07477 acyl-activating enzyme 12 (AAE12) similar to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501; identical to cDNA acyl-activating enzyme 12 (At1g65890) mRNA GI:29893228, acyl-activating enzyme 12 [Arabidopsis thaliana] GI:29893229 Length = 578 Score = 25.8 bits (54), Expect = 5.5 Identities = 20/66 (30%), Positives = 24/66 (36%), Gaps = 6/66 (9%) Query: 28 RDSKKCSDIVFDDESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPSDESEVDD 87 RD K +IV S+ Y K K + K HG G V P E+ D Sbjct: 387 RDGKTMGEIVMKGSSIMKGYLKNPKATYEAFK---HGWLNSGDVGVI---HPDGHVEIKD 440 Query: 88 RKKRCI 93 R K I Sbjct: 441 RSKDII 446 >At1g21530.1 68414.m02693 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501; identical to cDNA adenosine monophosphate binding protein 10 AMPBP10 (AMPBP10) GI:20799728 Length = 547 Score = 25.8 bits (54), Expect = 5.5 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 11/67 (16%) Query: 6 PEDRAGLKQ---MNNLTFTATDKGHR--------DSKKCSDIVFDDESVKLSYFKKRKTS 54 P +RA LK + L FT D R D +IVF SV L Y+K + + Sbjct: 348 PLERARLKSRQGVRTLGFTEVDVRDRKTGKSVKHDGVSVGEIVFRGSSVMLGYYKDPQGT 407 Query: 55 ESCDKSD 61 +C + D Sbjct: 408 AACMRED 414 >At5g55660.1 68418.m06940 expressed protein similar to unknown protein (pir||T08929) Length = 778 Score = 25.4 bits (53), Expect = 7.3 Identities = 20/88 (22%), Positives = 39/88 (44%), Gaps = 3/88 (3%) Query: 16 NNLTFTATDKGHRDSKKCSDIVFDDESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTD 75 N + + D+ + S+ ++ ++ES + + KKR + S DK + G + T V Sbjct: 554 NGIPDKSEDEAPQLSESEENVESEEESEEETKKKKRGSRTSSDKKESAGKSRSKKTAVPT 613 Query: 76 YRKPSDESEVDDRKKRCIDRYDSSESSD 103 P ++ +K+ R S + SD Sbjct: 614 KSSPPKKA---TQKRSAGKRKKSDDDSD 638 >At5g01980.1 68418.m00117 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 493 Score = 25.4 bits (53), Expect = 7.3 Identities = 9/28 (32%), Positives = 17/28 (60%) Query: 76 YRKPSDESEVDDRKKRCIDRYDSSESSD 103 Y P+D+ + ++ K+ +D + S SSD Sbjct: 392 YELPTDDKDYEEGKRNVLDVSEDSSSSD 419 >At3g56720.1 68416.m06309 expressed protein Length = 386 Score = 25.4 bits (53), Expect = 7.3 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 67 EDGTTVVTDYRKPSDESEVDDRKKRCIDRYDSSESSD 103 +DG T +RKPS++ ++R + D S SSD Sbjct: 11 DDGGDTTTAFRKPSNDGTSRKYRRRAL-ADDGSSSSD 46 >At1g77590.1 68414.m09034 long-chain-fatty-acid--CoA ligase family protein / long-chain acyl-CoA synthetase family protein (LACS9) similar to LACS 3 [SP|O95573] from Homo Sapiens, LACS 3 [SP|Q63151] from Rattus norvegicus; contains Pfam HMM hit: AMP-binding enzymes PF00501 Length = 691 Score = 25.4 bits (53), Expect = 7.3 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 35 DIVFDDESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPSDESEVDDRKK 90 +IV ++ L YFK + ++ K D G+ T + + P E+ DRKK Sbjct: 499 EIVIGGSNITLGYFKNEEKTKEVYKVDEKGMRWFYTGDIGRFH-PDGCLEIIDRKK 553 >At5g53930.1 68418.m06710 expressed protein Length = 529 Score = 25.0 bits (52), Expect = 9.6 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 10/79 (12%) Query: 34 SDIVFDDESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTD---YRKPSDESEVDDR-- 88 S + D S KL KK+K+ + K R + ++ + +D Y D+ + Sbjct: 7 SSKIIKDSSNKLRSVKKKKSKRNKSKKIRR-IKDESESSGSDSSLYSSSEDDYRRKKKRR 65 Query: 89 ----KKRCIDRYDSSESSD 103 KKR RY SSES D Sbjct: 66 SKLSKKRSRKRYSSSESDD 84 >At5g35160.1 68418.m04167 endomembrane protein 70, putative p76, Homo sapiens, EMBL:HSU81006 Length = 627 Score = 25.0 bits (52), Expect = 9.6 Identities = 12/53 (22%), Positives = 25/53 (47%) Query: 33 CSDIVFDDESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPSDESEV 85 CS + + KL +++ T CD + ++G ++V Y +ES++ Sbjct: 189 CSFAHNGESTKKLKMYERYTTPIKCDSTRVSMSVKEGQSIVFSYEVSFEESDI 241 >At2g44250.1 68415.m05506 expressed protein contains Pfam profile PF03080: Arabidopsis proteins of unknown function Length = 409 Score = 25.0 bits (52), Expect = 9.6 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 5/57 (8%) Query: 50 KRKTSESCDKSDR---HGVAEDGTTVVTDYRKPSDESEVDDRKKRCID--RYDSSES 101 +R+T + +SD HG T T Y P D++EV + +D Y S+S Sbjct: 121 RRRTRDDLLRSDSIKTHGRKNPPTISPTTYHLPDDQTEVHEHASVYLDYGEYHGSKS 177 >At1g76810.1 68414.m08938 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to IF2 protein [Drosophila melanogaster] GI:7108770; contains Pfam profile PF03144: Elongation factor Tu domain 2 Length = 1294 Score = 25.0 bits (52), Expect = 9.6 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Query: 29 DSKKCSDIVFDDESVKLSYFKKRKTSESCDKSDRHGVAEDGTTVVTDYRKPSDESEVD 86 +S+ + + D+ES ++++ K+K+S+ S V +D V D K SD V+ Sbjct: 223 NSRDDENTIEDEESPEVTFSGKKKSSKKKGGSVLASVGDDS---VADETKTSDTKNVE 277 >At1g10320.1 68414.m01162 U2 snRNP auxiliary factor-related similar to U2 small nuclear ribonucleoprotein auxiliary factor 35 kD subunit related protein 1 (sp|Q15695) Length = 757 Score = 25.0 bits (52), Expect = 9.6 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 4/73 (5%) Query: 23 TDKGHRDSKKCSDIVFDDESVKLSYFKKRKTSESCD----KSDRHGVAEDGTTVVTDYRK 78 +DK SK+ DD S KR++ E+ D K RH + T +D + Sbjct: 681 SDKDRDRSKQRQRYKSDDPESDQSRKGKRQSEENSDRETHKERRHRHRKRRRTQNSDDQN 740 Query: 79 PSDESEVDDRKKR 91 P + EV++ +R Sbjct: 741 PKESEEVEEEIER 753 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.309 0.126 0.354 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,654,979 Number of Sequences: 28952 Number of extensions: 102382 Number of successful extensions: 288 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 17 Number of HSP's that attempted gapping in prelim test: 269 Number of HSP's gapped (non-prelim): 36 length of query: 104 length of database: 12,070,560 effective HSP length: 71 effective length of query: 33 effective length of database: 10,014,968 effective search space: 330493944 effective search space used: 330493944 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -