BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000846-TA|BGIBMGA000846-PA|IPR001683|Phox-like, IPR001736|Phospholipase D/Transphosphatidylase (1199 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF117200-1|ABL67437.1| 421|Anopheles gambiae serpin 1 protein. 27 3.9 DQ974160-1|ABJ52800.1| 235|Anopheles gambiae serpin 1 protein. 27 3.9 >EF117200-1|ABL67437.1| 421|Anopheles gambiae serpin 1 protein. Length = 421 Score = 26.6 bits (56), Expect = 3.9 Identities = 14/39 (35%), Positives = 18/39 (46%) Query: 844 DMNNVSCQVLRSVSSWSGGFLDPDTVEQSIHEAYVDTIT 882 D V VL +SW F D T ++ H A DT+T Sbjct: 189 DAQLVLANVLFLKASWKNSFPDDQTHNRTFHVADGDTVT 227 >DQ974160-1|ABJ52800.1| 235|Anopheles gambiae serpin 1 protein. Length = 235 Score = 26.6 bits (56), Expect = 3.9 Identities = 14/39 (35%), Positives = 18/39 (46%) Query: 844 DMNNVSCQVLRSVSSWSGGFLDPDTVEQSIHEAYVDTIT 882 D V VL +SW F D T ++ H A DT+T Sbjct: 3 DAQLVLANVLFLKASWKNSFPDDQTHNRTFHVADGDTVT 41 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.321 0.136 0.412 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,199,331 Number of Sequences: 2123 Number of extensions: 48053 Number of successful extensions: 86 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 84 Number of HSP's gapped (non-prelim): 2 length of query: 1199 length of database: 516,269 effective HSP length: 72 effective length of query: 1127 effective length of database: 363,413 effective search space: 409566451 effective search space used: 409566451 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -