BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000844-TA|BGIBMGA000844-PA|IPR013057|Amino acid transporter, transmembrane (503 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprote... 25 6.3 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 8.3 >AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprotein protein. Length = 470 Score = 24.6 bits (51), Expect = 6.3 Identities = 13/32 (40%), Positives = 16/32 (50%) Query: 242 IANVFLVICFGITLYYIFKDLPVKSEATMVAS 273 I V +I FG Y + LPVK+E V S Sbjct: 16 IVQVVFIIVFGFCTDYAKELLPVKNETARVHS 47 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 24.2 bits (50), Expect = 8.3 Identities = 16/52 (30%), Positives = 25/52 (48%) Query: 386 KDKITVRYHNITQIAIRTAAVVGSVILAAAIPNLELVINLCGAIFLSTLGLL 437 ++K+TVR+ + ++R ILA + L L N GA LGL+ Sbjct: 31 EEKLTVRFTEVAGESVRYLGQTDEGILALSNYRLFLQKNTTGAEVSVPLGLI 82 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.326 0.138 0.418 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 462,856 Number of Sequences: 2123 Number of extensions: 16999 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 115 Number of HSP's gapped (non-prelim): 2 length of query: 503 length of database: 516,269 effective HSP length: 67 effective length of query: 436 effective length of database: 374,028 effective search space: 163076208 effective search space used: 163076208 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -