BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000838-TA|BGIBMGA000838-PA|IPR001766|Fork head transcription factor (218 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15898| Best HMM Match : Fork_head (HMM E-Value=0) 80 1e-15 SB_38328| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_53442| Best HMM Match : Fork_head (HMM E-Value=0) 79 3e-15 SB_32062| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_5069| Best HMM Match : Fork_head (HMM E-Value=0) 78 7e-15 SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_34624| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_665| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_5331| Best HMM Match : Fork_head (HMM E-Value=0) 73 1e-13 SB_3400| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_13048| Best HMM Match : Fork_head (HMM E-Value=0) 70 2e-12 SB_10836| Best HMM Match : Fork_head (HMM E-Value=0) 69 3e-12 SB_34638| Best HMM Match : Fork_head (HMM E-Value=0) 64 7e-11 SB_47058| Best HMM Match : Fork_head (HMM E-Value=0) 64 7e-11 SB_10139| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12905| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_17376| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_16501| Best HMM Match : Fork_head (HMM E-Value=3.3e-29) 60 1e-09 SB_14691| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51547| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 55 4e-08 SB_15500| Best HMM Match : Fork_head (HMM E-Value=1.7e-39) 53 2e-07 SB_39140| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_647| Best HMM Match : Fork_head (HMM E-Value=3.5e-21) 49 3e-06 SB_46386| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_5489| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_11344| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_40026| Best HMM Match : Fork_head (HMM E-Value=4.2e-05) 31 0.74 SB_34524| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_47633| Best HMM Match : Ank (HMM E-Value=1.7e-28) 29 3.0 SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_50183| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 4.0 SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) 29 4.0 SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_4349| Best HMM Match : efhand (HMM E-Value=0.00066) 28 5.2 SB_12924| Best HMM Match : Fork_head (HMM E-Value=0.88) 28 5.2 SB_39545| Best HMM Match : TolA (HMM E-Value=0.12) 28 6.9 SB_58526| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) 27 9.1 >SB_15898| Best HMM Match : Fork_head (HMM E-Value=0) Length = 460 Score = 80.2 bits (189), Expect = 1e-15 Identities = 41/99 (41%), Positives = 54/99 (54%), Gaps = 4/99 (4%) Query: 47 DDEPVVKEAKVDVESPAVRKPPYTYPELIERALRENGE--LTVSGIYQWISDRFPFYKAN 104 D V+ E + KPPY+Y LI A+ + E +T+S IYQWI D FP+YK Sbjct: 54 DPSAVLDETEARQHQTKESKPPYSYANLITFAINSSPEKKMTLSEIYQWICDHFPYYKEA 113 Query: 105 DERWKNSVRHNLSINPHFRKGARAPQ--GAGHLWSLAAN 141 WKNS+RHNLS+N F K R+ G G W++ N Sbjct: 114 GNGWKNSIRHNLSLNKCFIKVPRSKDDPGKGSYWAIDQN 152 >SB_38328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 267 Score = 79.8 bits (188), Expect = 2e-15 Identities = 44/101 (43%), Positives = 61/101 (60%), Gaps = 5/101 (4%) Query: 54 EAKVDVESPAVRKPPYTYPELIERALRENGE--LTVSGIYQWISDRFPFYKANDERWKNS 111 E K + P V KPPY+Y LI A+RE+ E LT++GIYQ+I +FP+Y+ N + W+NS Sbjct: 33 EGKDTSKDPNV-KPPYSYVALIAMAIRESPEKRLTLNGIYQYIISKFPYYEKNKKGWQNS 91 Query: 112 VRHNLSINPHFRKGARAPQG--AGHLWSLAANAIDLLPLRN 150 +RHNLS+N F K R G G+ W+L D+ N Sbjct: 92 IRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGN 132 >SB_53442| Best HMM Match : Fork_head (HMM E-Value=0) Length = 407 Score = 79.0 bits (186), Expect = 3e-15 Identities = 38/94 (40%), Positives = 55/94 (58%), Gaps = 4/94 (4%) Query: 49 EPVVKEAKVDVESPAVRKPPYTYPELIERALRENG--ELTVSGIYQWISDRFPFYKANDE 106 E + KE +D ++ KPPY+Y LI A+R+ ++T+S IY+WI + F FY+ D Sbjct: 81 ESISKEPNIDYKNDPNHKPPYSYATLICMAMRDTKRVKITLSAIYKWIKENFMFYRVADP 140 Query: 107 RWKNSVRHNLSINPHFRKGARAPQ--GAGHLWSL 138 W+NS+RHNLS+N F K R G G W + Sbjct: 141 TWQNSIRHNLSLNKCFVKVPRKKDEPGKGGFWRI 174 >SB_32062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 79.0 bits (186), Expect = 3e-15 Identities = 38/77 (49%), Positives = 52/77 (67%), Gaps = 4/77 (5%) Query: 66 KPPYTYPELIERALRE--NGELTVSGIYQWISDRFPFYKANDERWKNSVRHNLSINPHFR 123 KPPY+Y LI A+++ N LT+S IYQ+I D FP+Y+ N +RW+NS+RH+LS N F Sbjct: 39 KPPYSYISLITMAIQQSPNKMLTLSEIYQFIMDLFPYYRQNQQRWQNSIRHSLSFNDCFV 98 Query: 124 KGARAPQ--GAGHLWSL 138 K R+P G G W+L Sbjct: 99 KVPRSPDRPGKGSYWTL 115 >SB_5069| Best HMM Match : Fork_head (HMM E-Value=0) Length = 331 Score = 77.8 bits (183), Expect = 7e-15 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 4/90 (4%) Query: 51 VVKEAKVDVESPAVRKPPYTYPELIERALRENG--ELTVSGIYQWISDRFPFYKANDERW 108 V KE VD ++ KP ++Y LI A+ N ++ + IYQ+ISD FP+Y+ D+ W Sbjct: 69 VKKETIVDDDADV--KPAHSYIALIAMAILSNSSKKMILGDIYQYISDNFPYYRNKDKSW 126 Query: 109 KNSVRHNLSINPHFRKGARAPQGAGHLWSL 138 +NS+RHNLS+N F K R+ G G+ W++ Sbjct: 127 RNSIRHNLSLNECFIKAGRSENGKGNYWAI 156 >SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 77.0 bits (181), Expect = 1e-14 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 4/84 (4%) Query: 66 KPPYTYPELIERALRENGE--LTVSGIYQWISDRFPFYKANDERWKNSVRHNLSINPHFR 123 KPPY+Y LI A++ E +T+SGIY +I DRFP+Y+ N + W+NS+RHNLS+N F Sbjct: 58 KPPYSYIALIAMAIQSAPEKRITLSGIYSFIMDRFPYYRNNKQGWQNSIRHNLSLNECFV 117 Query: 124 KGARAPQ--GAGHLWSLAANAIDL 145 K R + G G W L +++++ Sbjct: 118 KVPRDDKKPGKGSFWMLDPDSLNM 141 >SB_34624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 392 Score = 75.8 bits (178), Expect = 3e-14 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 4/84 (4%) Query: 66 KPPYTYPELIERALRENGE--LTVSGIYQWISDRFPFYKANDERWKNSVRHNLSINPHFR 123 KPPY+Y LI A+ + + LT+S IY +IS RFPFY+ +WKNS+RHNL++N F Sbjct: 43 KPPYSYIALICMAITSSPQRQLTLSEIYDFISQRFPFYQTCSIKWKNSIRHNLTLNDCFI 102 Query: 124 KGARAPQ--GAGHLWSLAANAIDL 145 K R P G G+ W++ ++D+ Sbjct: 103 KLPREPNRPGKGNYWTIDPTSVDM 126 >SB_665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 73.7 bits (173), Expect = 1e-13 Identities = 33/81 (40%), Positives = 48/81 (59%), Gaps = 2/81 (2%) Query: 66 KPPYTYPELIERALRENGE--LTVSGIYQWISDRFPFYKANDERWKNSVRHNLSINPHFR 123 KP +Y LI A+ + E L +S IY +I R+P+++ W+NS+RHNLS+N F Sbjct: 80 KPNQSYISLISEAILSSPEQKLILSDIYNFILTRYPYFRTKGTGWRNSIRHNLSLNECFV 139 Query: 124 KGARAPQGAGHLWSLAANAID 144 K R+P G GH W++ A D Sbjct: 140 KAGRSPNGKGHFWAIDATYFD 160 >SB_5331| Best HMM Match : Fork_head (HMM E-Value=0) Length = 503 Score = 73.3 bits (172), Expect = 1e-13 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 4/77 (5%) Query: 66 KPPYTYPELIERALRE--NGELTVSGIYQWISDRFPFYKANDERWKNSVRHNLSINPHFR 123 KPPY+Y +LI +A+ + +LT+SGIY I+ +P+Y+ D+ W+NS+RHNLS+N +F Sbjct: 116 KPPYSYAQLIVQAILSATDKQLTLSGIYAHITKNYPYYRTADKGWQNSIRHNLSLNRYFV 175 Query: 124 KGARAPQ--GAGHLWSL 138 K RA G G W + Sbjct: 176 KVPRAQDEPGKGSFWRI 192 >SB_3400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 71.3 bits (167), Expect = 6e-13 Identities = 36/83 (43%), Positives = 56/83 (67%), Gaps = 5/83 (6%) Query: 61 SPAVRKPPYTYPELIERALRENG--ELTVSGIYQWISDRFPFYKANDER-WKNSVRHNLS 117 +PA +KPPY+Y LI A++++ ++T++GIY +I+ FP+Y ++R W+NS+RHNLS Sbjct: 56 TPAPQKPPYSYVALISMAIKQSPGRKITLNGIYHFITSAFPYYTWQNKRGWQNSIRHNLS 115 Query: 118 INPHFRKGAR--APQGAGHLWSL 138 +N F K R A G G W+L Sbjct: 116 LNRCFVKVHREKADPGKGCYWTL 138 >SB_13048| Best HMM Match : Fork_head (HMM E-Value=0) Length = 311 Score = 69.7 bits (163), Expect = 2e-12 Identities = 35/83 (42%), Positives = 52/83 (62%), Gaps = 4/83 (4%) Query: 60 ESPAVRKPPYTYPELIERALRENGE--LTVSGIYQWISDRFPFYKANDERWKNSVRHNLS 117 + A+ KPPY+Y LI A+ ++ + LT+S I ++I RFP+Y+ W+NS+RHNLS Sbjct: 58 QGTALSKPPYSYIALITMAILQSPQRKLTLSDICEFIKRRFPYYREKFPSWQNSIRHNLS 117 Query: 118 INPHFRKGARAP--QGAGHLWSL 138 +N F K R P G G+ W+L Sbjct: 118 LNDCFVKMPREPGNPGKGNYWTL 140 >SB_10836| Best HMM Match : Fork_head (HMM E-Value=0) Length = 458 Score = 68.9 bits (161), Expect = 3e-12 Identities = 40/94 (42%), Positives = 52/94 (55%), Gaps = 7/94 (7%) Query: 66 KPPYTYPELIERALRE--NGELTVSGIYQWISDRFPFYKANDERWKNSVRHNLSINPHFR 123 KPPY++ LI A+ E N L V IY WI D FP+++ WKNSVRHNLS+N F+ Sbjct: 122 KPPYSFSSLIFMAIEESPNKRLPVKDIYNWIMDHFPYFRDARLGWKNSVRHNLSLNKCFK 181 Query: 124 KGAR---APQGAGHLWSLAANAID--LLPLRNTP 152 K + G G LW++ + L LR TP Sbjct: 182 KVDKDKGQNVGKGSLWTVDPDFRPNLLQALRKTP 215 >SB_34638| Best HMM Match : Fork_head (HMM E-Value=0) Length = 312 Score = 64.5 bits (150), Expect = 7e-11 Identities = 31/85 (36%), Positives = 53/85 (62%), Gaps = 5/85 (5%) Query: 66 KPPYTYPELIERALRENGEL--TVSGIYQWISDRFPFYKANDERWKNSVRHNLSINPHFR 123 KPP++Y LI ++ + T++ IY++I RFP+++ N ++W+NS+RHNLS+N F Sbjct: 92 KPPFSYIALITMSIEASPYRMRTLNEIYEFIMTRFPYFRKNQQKWQNSIRHNLSLNDCFV 151 Query: 124 KGARA---PQGAGHLWSLAANAIDL 145 K R+ G G+ W+L + D+ Sbjct: 152 KVPRSIFGKPGKGNYWTLHPSCGDM 176 >SB_47058| Best HMM Match : Fork_head (HMM E-Value=0) Length = 312 Score = 64.5 bits (150), Expect = 7e-11 Identities = 31/85 (36%), Positives = 53/85 (62%), Gaps = 5/85 (5%) Query: 66 KPPYTYPELIERALRENGEL--TVSGIYQWISDRFPFYKANDERWKNSVRHNLSINPHFR 123 KPP++Y LI ++ + T++ IY++I RFP+++ N ++W+NS+RHNLS+N F Sbjct: 92 KPPFSYIALITMSIEASPYRMRTLNEIYEFIMTRFPYFRKNQQKWQNSIRHNLSLNDCFV 151 Query: 124 KGARA---PQGAGHLWSLAANAIDL 145 K R+ G G+ W+L + D+ Sbjct: 152 KVPRSIFGKPGKGNYWTLHPSCGDM 176 >SB_10139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/75 (37%), Positives = 44/75 (58%), Gaps = 2/75 (2%) Query: 66 KPPYTYPELIERALRE--NGELTVSGIYQWISDRFPFYKANDERWKNSVRHNLSINPHFR 123 KP +Y LI +A+ +L +S IY +I +P+++ W+NS+RHNLS+N F Sbjct: 99 KPSQSYIGLIGKAIMSVPQKKLVLSDIYNYILTHYPYFRNKGAGWRNSIRHNLSLNECFV 158 Query: 124 KGARAPQGAGHLWSL 138 K R+ G GH W++ Sbjct: 159 KVGRSSNGKGHFWAI 173 >SB_12905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 264 Score = 62.1 bits (144), Expect = 3e-10 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 4/78 (5%) Query: 65 RKPPYTYPELIERALRENGE--LTVSGIYQWISDRFPFYKANDERWKNSVRHNLSINPHF 122 R+PPY+Y LI A++ + E LT+ GI ++I DRFPFY+ WK +R+NLS+N F Sbjct: 108 RRPPYSYIALIAMAVQNSPEKRLTLDGICKFIRDRFPFYRETYPSWKICIRNNLSLNDCF 167 Query: 123 RK-GARAPQG-AGHLWSL 138 K G ++ + G+ W+L Sbjct: 168 IKTGIKSDEPLKGNYWTL 185 >SB_17376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 589 Score = 60.5 bits (140), Expect = 1e-09 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 2/74 (2%) Query: 65 RKPPYTYPELIERALRENGE--LTVSGIYQWISDRFPFYKANDERWKNSVRHNLSINPHF 122 RKP +Y LI A+ E+ E LT+S IY I +FP++ A WKN+VRHNLS++ F Sbjct: 18 RKPSTSYVALISTAILESAEKRLTLSEIYDAIELKFPWFTATRMGWKNTVRHNLSLHECF 77 Query: 123 RKGARAPQGAGHLW 136 KG + G W Sbjct: 78 VKGELSSNGKSCYW 91 >SB_16501| Best HMM Match : Fork_head (HMM E-Value=3.3e-29) Length = 594 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 2/79 (2%) Query: 46 PDDEPVVKEAKVDVESPAVRKPPYTYPELIERALRENGE--LTVSGIYQWISDRFPFYKA 103 PD + + D A +PP+TY LI +A+ ++ + LT++ IY W + F +++ Sbjct: 388 PDGISLDIQRSADFYQKADVRPPFTYASLIRQAILDSPDTQLTLNEIYSWFTRTFAYFRR 447 Query: 104 NDERWKNSVRHNLSINPHF 122 N WKN+VRHNLS++ F Sbjct: 448 NAATWKNAVRHNLSLHKCF 466 >SB_14691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 56.8 bits (131), Expect = 1e-08 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Query: 85 LTVSGIYQWISDRFP-FYKANDERWKNSVRHNLSINPHFRKGARAPQGAGHLWSL 138 +T+S IY +I+ +P F K W+NSVRHNLS N F K +RA G GH W + Sbjct: 146 MTLSSIYSFIAKNYPHFDKEKGPGWRNSVRHNLSSNDCFVKASRAENGKGHYWMI 200 >SB_51547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 55.2 bits (127), Expect = 4e-08 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Query: 85 LTVSGIYQWISDRFP-FYKANDERWKNSVRHNLSINPHFRKGARAPQGAGHLWSL 138 +T+S IY +I+ +P F K W+NSVRHNLS N F K +RA G GH W + Sbjct: 1 MTLSCIYSFIAKTYPHFDKEKGPGWRNSVRHNLSSNDCFVKASRAENGKGHYWMI 55 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/45 (55%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Query: 96 DRFPFYKANDERWKNSVRHNLSINPHFRKGARAPQ--GAGHLWSL 138 D FPFY+ N +RW+NS+RHNLS N F K R P G G LW+L Sbjct: 2 DHFPFYRDNTQRWQNSLRHNLSFNDCFVKIPRRPDQPGKGSLWAL 46 >SB_15500| Best HMM Match : Fork_head (HMM E-Value=1.7e-39) Length = 554 Score = 53.2 bits (122), Expect = 2e-07 Identities = 27/66 (40%), Positives = 41/66 (62%), Gaps = 2/66 (3%) Query: 66 KPPYTYPELIERALRENGE--LTVSGIYQWISDRFPFYKANDERWKNSVRHNLSINPHFR 123 KPP++Y LI A+ + E LT++ I +++ + F++ + + WKNSVRHNLS N F Sbjct: 133 KPPHSYIALIATAILNSPEKRLTLTEINEYLVKHYVFFRGSYQGWKNSVRHNLSFNKCFV 192 Query: 124 KGARAP 129 K R P Sbjct: 193 KILRDP 198 >SB_39140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 48.8 bits (111), Expect = 3e-06 Identities = 23/61 (37%), Positives = 39/61 (63%), Gaps = 7/61 (11%) Query: 69 YTYPELIERALRENGE--LTVSGIYQWISDRFPFYKANDER-----WKNSVRHNLSINPH 121 Y+Y +LI +A++ + E LT+S IY W+ + P+++ + WKNS+RHNLS++ Sbjct: 67 YSYADLITQAIQSSPEKRLTLSQIYDWMVNSVPYFRDKGDSNSSAGWKNSIRHNLSLHSK 126 Query: 122 F 122 F Sbjct: 127 F 127 >SB_647| Best HMM Match : Fork_head (HMM E-Value=3.5e-21) Length = 491 Score = 48.8 bits (111), Expect = 3e-06 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 5/92 (5%) Query: 23 DNDCASLAWLLNFRLDEVVNVRVPDDEPVVKEAKVDV--ESP-AVRKPPYTYPELIERAL 79 D ++ WL E++ + E V V+ SP +PPY+Y LI A+ Sbjct: 14 DESLTNIQWLCELESSELLLAKKGSRETEVTAPPVNAPPHSPNPYTRPPYSYATLILLAI 73 Query: 80 RENGE--LTVSGIYQWISDRFPFYKANDERWK 109 E +T+ IY+WI +RFP+Y + WK Sbjct: 74 NSTEEKRMTLQEIYKWIEERFPYYTKCKKAWK 105 >SB_46386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 10/75 (13%) Query: 58 DVESPAVRKPPY---TYPELIERALRENG--ELTVSGIYQWISDRFPFYKAND-----ER 107 D ++ +K P+ +Y +LI RA+ ++ +LT+ IY W P++KA + + Sbjct: 735 DDDATGEKKNPWGNASYSDLIARAIDQSKFQKLTLPQIYDWFVINVPYFKAKEHLPSTKG 794 Query: 108 WKNSVRHNLSINPHF 122 WKN++RH LS+ F Sbjct: 795 WKNAIRHTLSLRQRF 809 >SB_5489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 583 Score = 35.1 bits (77), Expect = 0.046 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 5/91 (5%) Query: 53 KEAKVDVESPA-VRKPPYTYPELIERALRENGE--LTVSGIYQWISDRFPFYKAND--ER 107 K +++ + P K +Y +L+ A+ + + LT+ IY W D + Sbjct: 433 KAFRIESKPPTNYSKGTVSYSDLLAEAISSSPDKRLTLQEIYMWFEDNVAGISPSSVTHD 492 Query: 108 WKNSVRHNLSINPHFRKGARAPQGAGHLWSL 138 WKN++RH LS F + A + + W++ Sbjct: 493 WKNTIRHTLSRRKRFLRIAMSEKKNKSWWTV 523 >SB_11344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 492 Score = 33.9 bits (74), Expect = 0.11 Identities = 21/33 (63%), Positives = 22/33 (66%), Gaps = 5/33 (15%) Query: 110 NSVRHNLSINPHFRKGARAPQGA----GHLWSL 138 NSVRHNLS+N F K R PQGA G LWSL Sbjct: 299 NSVRHNLSLNKAFCKLER-PQGASQRKGCLWSL 330 >SB_40026| Best HMM Match : Fork_head (HMM E-Value=4.2e-05) Length = 156 Score = 31.1 bits (67), Expect = 0.74 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Query: 53 KEAKVDVESPAVRKPPYTYPELIERALR--ENGELTVSGIYQWI 94 KE E KP ++Y LI A+R E LT+SGIY++I Sbjct: 48 KEKAGKDEQKNTEKPAFSYNALIMMAIRGSEEKRLTLSGIYEYI 91 >SB_34524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.7 bits (66), Expect = 0.98 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Query: 158 AAEPLHTAKIIGFPKVIVLDEAAIAAASIIPDQDLFSGSTMFLNPV 203 + EP+ +I GFPK ++ D ++ ++I QD F GS M LN V Sbjct: 49 STEPVVEVQINGFPKQVLNDPGSV--INLI-GQDEFQGSQMMLNTV 91 >SB_47633| Best HMM Match : Ank (HMM E-Value=1.7e-28) Length = 353 Score = 29.1 bits (62), Expect = 3.0 Identities = 22/92 (23%), Positives = 39/92 (42%), Gaps = 3/92 (3%) Query: 102 KANDERWKNSVRHNLSINPHFRKGARAPQGAGHLWSLAANAIDLLPLRNTPMPEEKAAEP 161 K N E ++ + +N + G A W + + N P+ P Sbjct: 152 KVNFEYLQSLLDKGADVNTRDKHGQTILHEAARSWGVDTARFLIQKGANINAPDVYGRCP 211 Query: 162 LHTAKIIGFPKVI--VLDEAA-IAAASIIPDQ 190 LH+A I +P+++ +LD A + AA++ DQ Sbjct: 212 LHSACIADYPEMVQYLLDSGADVNAATVTEDQ 243 >SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/40 (32%), Positives = 22/40 (55%) Query: 128 APQGAGHLWSLAANAIDLLPLRNTPMPEEKAAEPLHTAKI 167 AP+G + SL N +D LPL+ P+ +E + + K+ Sbjct: 85 APEGGEYDKSLPVNGVDSLPLKTHPVDDELPVDQILDDKL 124 >SB_50183| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 717 Score = 28.7 bits (61), Expect = 4.0 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Query: 113 RHNLSINPHFRKGARAPQGAGHLWSLAANAIDLLPLR---NTPMPEEKAAEP 161 R ++++PHF GA H SL +P R +TP+P+ + +P Sbjct: 233 RPTIAVDPHFTNDKEPSMGAAHT-SLQVRGDGKMPRRSEHSTPLPQPQPQQP 283 >SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) Length = 439 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/34 (41%), Positives = 15/34 (44%) Query: 39 EVVNVRVPDDEPVVKEAKVDVESPAVRKPPYTYP 72 EV + P PVV EA V P V P T P Sbjct: 58 EVTTTQAPPPPPVVTEAPTTVPPPVVTDAPTTVP 91 >SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Query: 48 DEPVVKEAKVDVESPAVRKPPYTY-PELIERALRENGELTVSGIYQWISDRFPFYKANDE 106 +E K + V + R P T+ ++ + +NGE+ +S +++ D++ + KA DE Sbjct: 378 EEGYFKASMVFPKEYPQRPPTLTFISDIWHPNVHKNGEVCISILHEPGEDKYGYEKA-DE 436 Query: 107 RWK 109 RW+ Sbjct: 437 RWR 439 >SB_4349| Best HMM Match : efhand (HMM E-Value=0.00066) Length = 188 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 81 ENGELTVSGIYQWISDRFPFYKANDERWK 109 +NG L +S +W +D P +A D +WK Sbjct: 26 KNGCLDLSEFMRWANDLEPMCQATDAKWK 54 >SB_12924| Best HMM Match : Fork_head (HMM E-Value=0.88) Length = 48 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Query: 70 TYPELIERALRENGE--LTVSGIYQWISD 96 TY EL+ +A+ + E LT+ GIY+W + Sbjct: 4 TYSELLAKAISSSPEQRLTLQGIYRWFEE 32 >SB_39545| Best HMM Match : TolA (HMM E-Value=0.12) Length = 1189 Score = 27.9 bits (59), Expect = 6.9 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 6/100 (6%) Query: 47 DDEPVVKEAKVDVESPAVRKPPYTYPELIERALRENGELTVSGIYQWISDRFPFYKANDE 106 DDE V+E +VDVE P R P E I ++E E + I W+ D K + Sbjct: 223 DDE--VEEEQVDVEKPLERDAPQPIHEEICAEIKETQESGIELI--WMDDEQE--KPRNT 276 Query: 107 RWKNSVRHNLSINPHFRKGARAPQGAGHLWSLAANAIDLL 146 +N + H+ + F + + L S +I++L Sbjct: 277 PDENQIDHDKVLEGMFENEISKNKASRPLASEEERSIEVL 316 >SB_58526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 27.5 bits (58), Expect = 9.1 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 4/82 (4%) Query: 3 TKTPESEKWRRRKLSKNIDNDNDCASLAWLLNFRLDEVVNVRVPDDEPVVKEAKVDVESP 62 T+T E E+W L+K +D + S + DE++ + + + K +V Sbjct: 110 TETIEKERWSH--LAKKVDKEQTPGSRSNSFRITADELIARKFTPKSSLNRRQKSEVFLS 167 Query: 63 AVRKPPYTYPELIERALRENGE 84 AV+K T P+ + + +EN E Sbjct: 168 AVQKFEGTVPDKLLK--KENME 187 >SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) Length = 1952 Score = 27.5 bits (58), Expect = 9.1 Identities = 24/78 (30%), Positives = 33/78 (42%), Gaps = 8/78 (10%) Query: 56 KVDVES--PAVRKPPYTYPELIERALRENG-ELTVSGIYQWISDRFPFYKANDERWKNSV 112 K++ ES P K P EL A+ G EL S D + +AN ERW+N Sbjct: 1422 KMNTESGLPQAWKEPVPLQELHNLAVTNLGRELDTSN-----PDDAMYIQANVERWRNKQ 1476 Query: 113 RHNLSINPHFRKGARAPQ 130 R + R+ RA + Sbjct: 1477 RQREKLRQEMREKERAKE 1494 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.134 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,989,856 Number of Sequences: 59808 Number of extensions: 335278 Number of successful extensions: 648 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 12 Number of HSP's that attempted gapping in prelim test: 602 Number of HSP's gapped (non-prelim): 43 length of query: 218 length of database: 16,821,457 effective HSP length: 79 effective length of query: 139 effective length of database: 12,096,625 effective search space: 1681430875 effective search space used: 1681430875 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -