BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000836-TA|BGIBMGA000836-PA|undefined (386 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCPJ732.01 |vps5||retromer complex subunit Vps5|Schizosaccharom... 28 1.9 SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|c... 27 5.9 >SPCPJ732.01 |vps5||retromer complex subunit Vps5|Schizosaccharomyces pombe|chr 3|||Manual Length = 576 Score = 28.3 bits (60), Expect = 1.9 Identities = 13/46 (28%), Positives = 23/46 (50%) Query: 304 LSSPLGALSPWGSSPDLARRTPLGSPDGDRTPTNEEEVPAVSPASS 349 L++ A PW S + +P+G+ + P +E+ V + ASS Sbjct: 115 LNADFSANKPWISEVNSFSPSPIGATENPTIPNSEQTVDTLDAASS 160 >SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 26.6 bits (56), Expect = 5.9 Identities = 12/43 (27%), Positives = 22/43 (51%) Query: 25 HAQLNTLTIMIVSNSWKFIAVLQRGVLLYYSNKAAARDSGRWR 67 +A +N L ++ S + + Q+ +L+Y SN + G WR Sbjct: 593 YACINPLVLLFASVLFCVNYLTQKYILMYVSNSSTESGGGYWR 635 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.312 0.125 0.361 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,313,955 Number of Sequences: 5004 Number of extensions: 44015 Number of successful extensions: 66 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 64 Number of HSP's gapped (non-prelim): 2 length of query: 386 length of database: 2,362,478 effective HSP length: 74 effective length of query: 312 effective length of database: 1,992,182 effective search space: 621560784 effective search space used: 621560784 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -