BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000836-TA|BGIBMGA000836-PA|undefined (386 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10302| Best HMM Match : VDE (HMM E-Value=4.4) 35 0.13 SB_22178| Best HMM Match : Involucrin2 (HMM E-Value=2.6) 30 3.7 >SB_10302| Best HMM Match : VDE (HMM E-Value=4.4) Length = 578 Score = 34.7 bits (76), Expect = 0.13 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 7/67 (10%) Query: 91 FSDGDSHKLAVPPVEDIAAA-RQAWVTALNEHIAYSGHYLWAGASPDTAKEATEELDEET 149 +SD H +V P + RQ W+ +L+EH AYS HY P +E D+ Sbjct: 106 YSDNTVHIWSVSPNDPAPQVQRQRWLNSLHEHCAYSTHYT---TQPTL---LVDEYDQNF 159 Query: 150 KPLGTMQ 156 PLG ++ Sbjct: 160 LPLGDIK 166 >SB_22178| Best HMM Match : Involucrin2 (HMM E-Value=2.6) Length = 311 Score = 29.9 bits (64), Expect = 3.7 Identities = 15/44 (34%), Positives = 21/44 (47%) Query: 301 TAGLSSPLGALSPWGSSPDLARRTPLGSPDGDRTPTNEEEVPAV 344 T G +P G P+G S + +TP G P R P+ PA+ Sbjct: 268 TCGFKAPFGLQVPYGYSVPCSLQTPYGYPVPYRCPSFSPWTPAM 311 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.312 0.125 0.361 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,943,788 Number of Sequences: 59808 Number of extensions: 357195 Number of successful extensions: 664 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 662 Number of HSP's gapped (non-prelim): 2 length of query: 386 length of database: 16,821,457 effective HSP length: 83 effective length of query: 303 effective length of database: 11,857,393 effective search space: 3592790079 effective search space used: 3592790079 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -