BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000836-TA|BGIBMGA000836-PA|undefined (386 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 2.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 4.9 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 22 6.5 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 6.5 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.4 bits (48), Expect = 2.8 Identities = 11/37 (29%), Positives = 21/37 (56%) Query: 12 LAHSTTAITNTTSHAQLNTLTIMIVSNSWKFIAVLQR 48 L + + I + ++ A + T+ I V N WKFI +++ Sbjct: 435 LINVPSLIIHVSTSAYVATVWINSVINRWKFIEFIRK 471 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 4.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Query: 113 AWVTALNEHIAYSGHYLWAGASP 135 AWVT L + G+ L A SP Sbjct: 1542 AWVTELKQAFKPKGYLLSAAVSP 1564 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.2 bits (45), Expect = 6.5 Identities = 13/48 (27%), Positives = 19/48 (39%) Query: 327 GSPDGDRTPTNEEEVPAVSPASSRGTLVSAGGHVYRNARPYAPCTRRR 374 G PD ++ EV P T+ + GG + +N P RR Sbjct: 14 GMPDESINISDVIEVIETDPDFHESTMFNGGGEIPQNIIQQQPQQARR 61 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 6.5 Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 333 RTPTNEEEVPAVSPASSRGTLVSAGGHVYRNA 364 R + + VP ++PA RG + +A V A Sbjct: 158 RHHVDHQPVPYLTPADDRGRVAAAAAMVAETA 189 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.312 0.125 0.361 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,805 Number of Sequences: 317 Number of extensions: 2432 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 4 length of query: 386 length of database: 114,650 effective HSP length: 58 effective length of query: 328 effective length of database: 96,264 effective search space: 31574592 effective search space used: 31574592 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -