BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000836-TA|BGIBMGA000836-PA|undefined
(386 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 5.8
>DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly
protein 9 protein.
Length = 423
Score = 22.6 bits (46), Expect = 5.8
Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 3/52 (5%)
Query: 7 LMEATLAHSTTAITNTTSHAQLNTLTIMIV--SNSWKFIAVLQRGVLLYYSN 56
L + + H AI +TT + T + +N+W +IA ++ L+ Y+N
Sbjct: 165 LKQVKIPHDI-AINSTTGKRNVVTPIVQSFDYNNTWVYIADVEGYALIIYNN 215
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.312 0.125 0.361
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 83,967
Number of Sequences: 429
Number of extensions: 3270
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 1
length of query: 386
length of database: 140,377
effective HSP length: 59
effective length of query: 327
effective length of database: 115,066
effective search space: 37626582
effective search space used: 37626582
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 45 (22.2 bits)
- SilkBase 1999-2023 -