BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000836-TA|BGIBMGA000836-PA|undefined (386 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 5.8 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.6 bits (46), Expect = 5.8 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Query: 7 LMEATLAHSTTAITNTTSHAQLNTLTIMIV--SNSWKFIAVLQRGVLLYYSN 56 L + + H AI +TT + T + +N+W +IA ++ L+ Y+N Sbjct: 165 LKQVKIPHDI-AINSTTGKRNVVTPIVQSFDYNNTWVYIADVEGYALIIYNN 215 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.312 0.125 0.361 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,967 Number of Sequences: 429 Number of extensions: 3270 Number of successful extensions: 3 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 1 length of query: 386 length of database: 140,377 effective HSP length: 59 effective length of query: 327 effective length of database: 115,066 effective search space: 37626582 effective search space used: 37626582 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -