SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000836-TA|BGIBMGA000836-PA|undefined
         (386 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly pro...    23   5.8  

>DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly
           protein 9 protein.
          Length = 423

 Score = 22.6 bits (46), Expect = 5.8
 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 7   LMEATLAHSTTAITNTTSHAQLNTLTIMIV--SNSWKFIAVLQRGVLLYYSN 56
           L +  + H   AI +TT    + T  +     +N+W +IA ++   L+ Y+N
Sbjct: 165 LKQVKIPHDI-AINSTTGKRNVVTPIVQSFDYNNTWVYIADVEGYALIIYNN 215


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.312    0.125    0.361 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 83,967
Number of Sequences: 429
Number of extensions: 3270
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 1
length of query: 386
length of database: 140,377
effective HSP length: 59
effective length of query: 327
effective length of database: 115,066
effective search space: 37626582
effective search space used: 37626582
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 45 (22.2 bits)

- SilkBase 1999-2023 -