BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000832-TA|BGIBMGA000832-PA|IPR001245|Tyrosine protein kinase, IPR011009|Protein kinase-like, IPR000719|Protein kinase, IPR002290|Serine/threonine protein kinase (184 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33962| Best HMM Match : No HMM Matches (HMM E-Value=.) 128 4e-30 SB_22527| Best HMM Match : No HMM Matches (HMM E-Value=.) 127 5e-30 SB_18879| Best HMM Match : Pkinase_Tyr (HMM E-Value=7e-36) 126 1e-29 SB_42485| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 125 2e-29 SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 125 3e-29 SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 124 3e-29 SB_10993| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-38) 124 6e-29 SB_23137| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 124 6e-29 SB_33663| Best HMM Match : No HMM Matches (HMM E-Value=.) 123 8e-29 SB_33662| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 1e-28 SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) 119 2e-27 SB_30884| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.8e-33) 118 4e-27 SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) 115 2e-26 SB_1550| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 115 2e-26 SB_23401| Best HMM Match : No HMM Matches (HMM E-Value=.) 115 2e-26 SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 6e-26 SB_43850| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 1e-24 SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 105 3e-23 SB_16900| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 9e-23 SB_23400| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_59149| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_52372| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.8e-35) 99 3e-21 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 4e-21 SB_42486| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 98 4e-21 SB_42225| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 97 6e-21 SB_8553| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_11148| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 95 2e-20 SB_35913| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 90 9e-19 SB_10779| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 9e-19 SB_31555| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 86 1e-17 SB_28925| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 86 1e-17 SB_28361| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 85 3e-17 SB_19226| Best HMM Match : I-set (HMM E-Value=0) 84 6e-17 SB_39694| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 83 2e-16 SB_6592| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_21044| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 82 3e-16 SB_40820| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 79 2e-15 SB_19482| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-11) 77 1e-14 SB_7022| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.2e-08) 76 2e-14 SB_289| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.5e-32) 75 3e-14 SB_53713| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 4e-14 SB_9759| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 73 1e-13 SB_46968| Best HMM Match : Pkinase_Tyr (HMM E-Value=8e-08) 72 3e-13 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 65 3e-11 SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 5e-10 SB_22969| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_12642| Best HMM Match : Pkinase (HMM E-Value=5.3e-07) 57 8e-09 SB_37607| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-23) 56 2e-08 SB_26337| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-21) 56 2e-08 SB_43991| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 3e-08 SB_13537| Best HMM Match : Pkinase (HMM E-Value=4e-11) 55 3e-08 SB_41626| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 3e-08 SB_11943| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 55 4e-08 SB_57129| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 55 4e-08 SB_43870| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 54 5e-08 SB_42680| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 54 7e-08 SB_51259| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.4e-08) 54 7e-08 SB_21166| Best HMM Match : Pkinase (HMM E-Value=0) 53 1e-07 SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 51 5e-07 SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) 51 5e-07 SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) 51 7e-07 SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) 50 9e-07 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 48 5e-06 SB_9978| Best HMM Match : Pkinase (HMM E-Value=3.4e-17) 47 1e-05 SB_37572| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_24478| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_51157| Best HMM Match : Pkinase (HMM E-Value=0.00029) 46 2e-05 SB_30649| Best HMM Match : zf-C2H2 (HMM E-Value=1.7e-24) 46 2e-05 SB_45| Best HMM Match : Pkinase (HMM E-Value=0) 45 3e-05 SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) 45 4e-05 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_14773| Best HMM Match : Pkinase (HMM E-Value=1.1e-05) 44 8e-05 SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) 44 8e-05 SB_54329| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.16) 44 1e-04 SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_26833| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) 42 2e-04 SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) 42 2e-04 SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) 42 3e-04 SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) 42 3e-04 SB_53036| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_8000| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) 41 5e-04 SB_49051| Best HMM Match : Pkinase_Tyr (HMM E-Value=7.5e-11) 41 5e-04 SB_40460| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_41623| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56201| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_18129| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) 40 0.001 SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_41930| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.4e-10) 40 0.002 SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_26242| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.8e-15) 39 0.002 SB_47182| Best HMM Match : Pkinase (HMM E-Value=1e-09) 39 0.002 SB_41406| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_25618| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_7625| Best HMM Match : Pkinase (HMM E-Value=6.8e-10) 38 0.004 SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.005 SB_37367| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.005 SB_8354| Best HMM Match : Pkinase (HMM E-Value=6.3e-15) 38 0.005 SB_30278| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_10421| Best HMM Match : Guanylate_cyc (HMM E-Value=0) 38 0.007 SB_6315| Best HMM Match : GBP_PSP (HMM E-Value=5.2) 38 0.007 SB_59282| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.6e-10) 37 0.009 SB_1646| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_51866| Best HMM Match : Pkinase (HMM E-Value=0) 36 0.015 SB_29500| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.015 SB_22843| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.015 SB_18146| Best HMM Match : Pkinase (HMM E-Value=0) 36 0.015 SB_28889| Best HMM Match : ANF_receptor (HMM E-Value=1.1e-34) 36 0.020 SB_25669| Best HMM Match : LRR_1 (HMM E-Value=9.1e-33) 36 0.020 SB_18109| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_24824| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.32) 36 0.026 SB_36802| Best HMM Match : Pkinase (HMM E-Value=2.2e-23) 35 0.035 SB_55593| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.035 SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) 35 0.035 SB_9361| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.035 SB_34104| Best HMM Match : SH2 (HMM E-Value=1.6e-24) 35 0.046 SB_18517| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_18360| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.061 SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.061 SB_45888| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.4e-25) 34 0.061 SB_44566| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.061 SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) 33 0.11 SB_7330| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_58458| Best HMM Match : Guanylate_cyc (HMM E-Value=1.2e-36) 33 0.14 SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.14 SB_22670| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.14 SB_55533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.14 SB_26437| Best HMM Match : Pkinase (HMM E-Value=3.6e-36) 33 0.14 SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) 33 0.14 SB_22496| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_7684| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) 33 0.19 SB_42333| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_43658| Best HMM Match : Pkinase (HMM E-Value=1.49939e-42) 32 0.33 SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) 32 0.33 SB_10837| Best HMM Match : Pkinase (HMM E-Value=1.49939e-42) 32 0.33 SB_18047| Best HMM Match : Pkinase (HMM E-Value=2.1e-07) 31 0.43 SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.43 SB_11487| Best HMM Match : Guanylate_cyc (HMM E-Value=2.3e-06) 31 0.43 SB_1987| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.43 SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) 31 0.57 SB_52266| Best HMM Match : DUF1665 (HMM E-Value=1.3) 31 0.57 SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) 31 0.57 SB_55159| Best HMM Match : Ribosomal_S17e (HMM E-Value=2.8) 31 0.75 SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_41151| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_34306| Best HMM Match : Pkinase (HMM E-Value=0) 30 0.99 SB_1344| Best HMM Match : HGTP_anticodon (HMM E-Value=4.4) 30 0.99 SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) 30 1.3 SB_41218| Best HMM Match : zf-C2H2 (HMM E-Value=0.68) 30 1.3 SB_4396| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_58457| Best HMM Match : Guanylate_cyc (HMM E-Value=0) 29 1.7 SB_54823| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) 29 1.7 SB_4000| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.2e-09) 29 1.7 SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) 29 2.3 SB_42528| Best HMM Match : Pkinase (HMM E-Value=1.3e-13) 29 2.3 SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20) 29 2.3 SB_1188| Best HMM Match : Guanylate_cyc (HMM E-Value=6.7) 29 2.3 SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) 28 4.0 SB_50980| Best HMM Match : Guanylate_cyc (HMM E-Value=0) 28 4.0 SB_2079| Best HMM Match : Pkinase (HMM E-Value=4.2e-10) 28 4.0 SB_54275| Best HMM Match : Galactosyl_T (HMM E-Value=2.4e-20) 28 5.3 SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) 28 5.3 SB_34265| Best HMM Match : rve (HMM E-Value=0.0015) 28 5.3 SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) 28 5.3 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 28 5.3 SB_12086| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.2e-07) 28 5.3 SB_1495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_54204| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.0 SB_54589| Best HMM Match : Extensin_2 (HMM E-Value=0.0081) 27 9.3 SB_42409| Best HMM Match : Pkinase (HMM E-Value=6.7e-24) 27 9.3 SB_31810| Best HMM Match : Pkinase (HMM E-Value=0.17) 27 9.3 >SB_33962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 823 Score = 128 bits (308), Expect = 4e-30 Identities = 59/132 (44%), Positives = 87/132 (65%), Gaps = 4/132 (3%) Query: 13 DLAARNILVDSTGVLKVADFGLSR----SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLAARN+LVD LK+ DFGL+R + +YV + +P++W+APEA+ +Y SK+D Sbjct: 486 DLAARNVLVDEGYALKIGDFGLARDIYKTDLYVKKGAGLLPVKWMAPEALFDREYSSKTD 545 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPH 128 VWAF V+LWEI TLGG PY + Q+ ++ G R+ +P +Y +M +CWS +P Sbjct: 546 VWAFGVVLWEILTLGGSPYPGVPLEQLLDYINEGKRMAQPRDCPPEIYAIMCDCWSLEPD 605 Query: 129 DRPTFAQIVDKL 140 RPTFA++V ++ Sbjct: 606 RRPTFAELVRRI 617 >SB_22527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 127 bits (307), Expect = 5e-30 Identities = 70/166 (42%), Positives = 97/166 (58%), Gaps = 14/166 (8%) Query: 13 DLAARNILVDSTGVLKVADFGLSR---SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDV 69 DLAARN+LV V KVADFGL+R +Y S+ +PL+W++ EAI + S+SDV Sbjct: 756 DLAARNVLVGDNKVAKVADFGLTRHMYEDLYQGKTSRKLPLKWMSIEAIFDQAFTSQSDV 815 Query: 70 WAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPHD 129 WA+ V LWE+ TLGG PY + N ++ L G R+ KP + LY +M+ CW D P D Sbjct: 816 WAYGVFLWELVTLGGTPYPTIGNRELLKLLKEGYRMEKPDMCNDDLYTIMLSCWKDKPED 875 Query: 130 RPTFAQI---VDKLVIQQQLYVDLECVLPPSEEDIGFKDYDYTLPS 172 RPTF + ++ L+++ Y D PS D +DY Y +PS Sbjct: 876 RPTFENLRSTLEDLMMRDNPYFD------PSAVDES-RDY-YNVPS 913 >SB_18879| Best HMM Match : Pkinase_Tyr (HMM E-Value=7e-36) Length = 617 Score = 126 bits (304), Expect = 1e-29 Identities = 54/136 (39%), Positives = 84/136 (61%), Gaps = 3/136 (2%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS---GVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDV 69 DL ARN+LV K++D GL+R +Y T S +P++W+ PE++++ Q S SDV Sbjct: 460 DLVARNVLVGEHNTCKISDLGLARDVSQDIYTRTSSARLPVKWMPPESLLYGQSNSASDV 519 Query: 70 WAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPHD 129 W++ ++LWEI T+G PY + N +P + G R+PKP+ LY +M+ CW +DP + Sbjct: 520 WSYGIVLWEIFTIGDSPYPGVGNDYIPRMIREGYRMPKPVHVWDALYFVMLRCWQEDPDE 579 Query: 130 RPTFAQIVDKLVIQQQ 145 RPTF ++ D + QQ Sbjct: 580 RPTFDELCDNMQALQQ 595 >SB_42485| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1565 Score = 125 bits (302), Expect = 2e-29 Identities = 58/132 (43%), Positives = 84/132 (63%), Gaps = 4/132 (3%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS----GVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLAARN+LV V+KV+DFGL+R +YV T S +P++W+APE++ Y K+D Sbjct: 1262 DLAARNVLVGPDYVMKVSDFGLARDIYQDDLYVKTTSGLLPVKWMAPESLFDRVYTEKTD 1321 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPH 128 VW+F +LLWEI TLGG PY L Q+ +L+ G R+ +P + +Y +M +CW P Sbjct: 1322 VWSFGILLWEIMTLGGTPYPGLPTEQLLDYLSEGQRMAQPQNCPLEIYTIMRDCWMQLPD 1381 Query: 129 DRPTFAQIVDKL 140 RP F +V++L Sbjct: 1382 QRPHFGTLVERL 1393 >SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1038 Score = 125 bits (301), Expect = 3e-29 Identities = 59/165 (35%), Positives = 98/165 (59%), Gaps = 7/165 (4%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS----GVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLAARN L+ VLK++DFG+SR G+Y + + +P++W APEA+ ++QY + SD Sbjct: 706 DLAARNCLIGEDDVLKISDFGMSREVYDEGLYEASNMREIPVKWTAPEALNYAQYTTLSD 765 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPH 128 +W+F VLLWE + G PY L+N + + G R+P PM +Y++M +CW+ DP Sbjct: 766 IWSFGVLLWETFSFGNTPYPGLNNKETRDKVEQGYRMPPPMGTPPTIYQIMKDCWNIDPE 825 Query: 129 DRPTFAQIVDKLVIQQQLYVDLECVLPPSEEDIGFKDYDYTLPSP 173 RP F +++ +L +Q+ + P+ +G D+ ++ +P Sbjct: 826 ARPKFDELLRRL---KQVKEQVGATPSPNPRHLGPLDFVFSAKTP 867 >SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 2629 Score = 124 bits (300), Expect = 3e-29 Identities = 54/136 (39%), Positives = 84/136 (61%), Gaps = 3/136 (2%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS---GVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDV 69 DLAARN+LV K++D GL+R +Y T S +P++W+ PE++++ Q S SDV Sbjct: 285 DLAARNVLVGEHNTCKISDLGLARDVSQDIYTRTSSARLPVKWMPPESLLYGQSSSASDV 344 Query: 70 WAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPHD 129 W++ ++LWEI T+G PY + + +P L G R+PKP LY +M+ CW +DP + Sbjct: 345 WSYGIVLWEIFTIGDSPYPGVKSKGIPRMLREGYRMPKPPHVGDALYCVMLRCWQEDPDE 404 Query: 130 RPTFAQIVDKLVIQQQ 145 RPTF ++ D + Q+ Sbjct: 405 RPTFDELRDNMQALQR 420 >SB_10993| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-38) Length = 344 Score = 124 bits (298), Expect = 6e-29 Identities = 65/154 (42%), Positives = 93/154 (60%), Gaps = 5/154 (3%) Query: 7 GPVCPY-DLAARNILVDSTGVLKVADFGLSR----SGVYVHTRSKPVPLRWLAPEAIVHS 61 G +C + DLAARNI++++ V V+DFGLSR SG Y +T +P+RW+A E++ Sbjct: 161 GDMCVHRDLAARNIILNADNVAMVSDFGLSRDVYESGAYDNTTGGVLPVRWMAIESLEDY 220 Query: 62 QYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVE 121 Y +KSDVW++ VLLWE+ + PYA +S ++ L G RL KP S LY LM E Sbjct: 221 TYTTKSDVWSYGVLLWEMESGALMPYAGMSGVEILKRLKQGYRLEKPSCCSQELYALMYE 280 Query: 122 CWSDDPHDRPTFAQIVDKLVIQQQLYVDLECVLP 155 CW+ +P +RP F+ IV +L + E +LP Sbjct: 281 CWNPEPKNRPAFSDIVSRLEETLRAKAGYEEILP 314 >SB_23137| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1022 Score = 124 bits (298), Expect = 6e-29 Identities = 65/154 (42%), Positives = 93/154 (60%), Gaps = 5/154 (3%) Query: 7 GPVCPY-DLAARNILVDSTGVLKVADFGLSR----SGVYVHTRSKPVPLRWLAPEAIVHS 61 G +C + DLAARNI++++ V V+DFGLSR SG Y +T +P+RW+A E++ Sbjct: 839 GDMCVHRDLAARNIILNADNVAMVSDFGLSRDVYESGAYDNTTGGVLPVRWMAIESLEDY 898 Query: 62 QYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVE 121 Y +KSDVW++ VLLWE+ + PYA +S ++ L G RL KP S LY LM E Sbjct: 899 TYTTKSDVWSYGVLLWEMESGALMPYAGMSGVEILKRLKQGYRLEKPSCCSQELYALMYE 958 Query: 122 CWSDDPHDRPTFAQIVDKLVIQQQLYVDLECVLP 155 CW+ +P +RP F+ IV +L + E +LP Sbjct: 959 CWNPEPKNRPAFSDIVSRLEETLRAKAGYEEILP 992 >SB_33663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 123 bits (297), Expect = 8e-29 Identities = 58/124 (46%), Positives = 74/124 (59%), Gaps = 3/124 (2%) Query: 13 DLAARNILVDSTGVLKVADFGLSR---SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDV 69 DLAARNILV +KVADFGLSR +Y P++W APEA + Q+ KSDV Sbjct: 372 DLAARNILVGENNTVKVADFGLSRLIEDDIYCAHEGAKFPIKWTAPEACLQGQFSIKSDV 431 Query: 70 WAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPHD 129 W+F +LL E+ T G PY ++N +V + G R+PKP R YE+M +CW DP Sbjct: 432 WSFGILLMELVTFGRIPYPGMTNREVVEQVERGYRMPKPNNCPERFYEIMKDCWKKDPMQ 491 Query: 130 RPTF 133 RPTF Sbjct: 492 RPTF 495 >SB_33662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 122 bits (295), Expect = 1e-28 Identities = 56/124 (45%), Positives = 79/124 (63%), Gaps = 3/124 (2%) Query: 13 DLAARNILVDSTGVLKVADFGLSR---SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDV 69 DLAARNILV ++K+ADFGLSR G Y P++W APEA +++++ KSDV Sbjct: 363 DLAARNILVGEKNIVKIADFGLSRLIDEGEYTARAGAKFPIKWTAPEAALYNKFTIKSDV 422 Query: 70 WAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPHD 129 W+F +LL E+ T G PY + N +V A + G R+P PM+ LY++M++CW P + Sbjct: 423 WSFGILLTELVTYGRIPYPGMGNAEVLAQVERGYRMPCPMKCPPLLYQIMLDCWKQIPEE 482 Query: 130 RPTF 133 RPTF Sbjct: 483 RPTF 486 >SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 119 bits (286), Expect = 2e-27 Identities = 59/141 (41%), Positives = 83/141 (58%), Gaps = 5/141 (3%) Query: 1 MGALGTGPVCPYDLAARNILVDSTGVLKVADFGL----SRSGVYVHTRSKPVPLRWLAPE 56 M L + + DLAARNILV V KVADFG+ S +Y+ T +P++W A E Sbjct: 550 MEYLSSQKIIHRDLAARNILVGEGEVCKVADFGMAKDVSNEDIYIRTTEGRLPVKWTAVE 609 Query: 57 AIVHS-QYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRL 115 A++ +Y + SDVW+F V+L+EI T+GG PY ++ +P L G R+P P L Sbjct: 610 ALIGGGEYTTLSDVWSFGVVLYEICTIGGEPYPGIAGKDIPDCLETGYRMPCPTHVDATL 669 Query: 116 YELMVECWSDDPHDRPTFAQI 136 Y++M CW+ P DRPTFA + Sbjct: 670 YQVMASCWATCPDDRPTFASL 690 >SB_30884| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.8e-33) Length = 308 Score = 118 bits (283), Expect = 4e-27 Identities = 60/136 (44%), Positives = 80/136 (58%), Gaps = 8/136 (5%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS--------GVYVHTRSKPVPLRWLAPEAIVHSQYC 64 DLAARNILV KV+DFGLSR T+ +P+RW APEAI + ++ Sbjct: 13 DLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFS 72 Query: 65 SKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWS 124 S SDVW++ +LLWEI + G PY N+QV + GG RLP PM+ ++ LM++CW Sbjct: 73 SASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPMKCPKVIHNLMLDCWD 132 Query: 125 DDPHDRPTFAQIVDKL 140 + RP FA IV +L Sbjct: 133 KEKTSRPKFADIVQRL 148 >SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1052 Score = 115 bits (277), Expect = 2e-26 Identities = 53/128 (41%), Positives = 81/128 (63%), Gaps = 4/128 (3%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS----GVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLAARNILV V+K+ADFGL+R+ Y +P++WLA EA+ Y ++SD Sbjct: 874 DLAARNILVGEDYVMKIADFGLARNVRDMDYYRKATDGRLPIKWLAIEALFDRVYTTQSD 933 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPH 128 VW F +LLWEI TLGG PY + ++ L G R+ P + ++Y++M+ CW+++P+ Sbjct: 934 VWTFGILLWEIFTLGGSPYPGIPVEKLFELLKSGYRMQMPQKCPDKMYDIMLSCWNENPN 993 Query: 129 DRPTFAQI 136 RP+F ++ Sbjct: 994 ARPSFTEL 1001 >SB_1550| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 931 Score = 115 bits (277), Expect = 2e-26 Identities = 59/133 (44%), Positives = 78/133 (58%), Gaps = 8/133 (6%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS--------GVYVHTRSKPVPLRWLAPEAIVHSQYC 64 DLAARNILV KV+DFGLSR T+ +P+RW APEAI + ++ Sbjct: 696 DLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFS 755 Query: 65 SKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWS 124 S SDVW++ +LLWEI + G PY N+QV + GG RLP PM+ ++ LM++CW Sbjct: 756 SASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPMKCPKVIHNLMLDCWD 815 Query: 125 DDPHDRPTFAQIV 137 + RP FA IV Sbjct: 816 KEKTSRPKFADIV 828 >SB_23401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 115 bits (277), Expect = 2e-26 Identities = 48/128 (37%), Positives = 82/128 (64%), Gaps = 4/128 (3%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS----GVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLA RN+LV K+ DFGLSR G+Y++ + +PL+W+APE+++ Y ++SD Sbjct: 219 DLATRNVLVTEDLTAKITDFGLSRDIYSDGIYLNAKGGKLPLKWMAPESLLDYVYTTQSD 278 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPH 128 +W+F VL+WE+ + G PY+ + ++ + L G RL +P +Y++M+ CW+ +P Sbjct: 279 IWSFGVLMWEVWSFGAMPYSAVVPNELLSMLMSGFRLSRPPLCPEEIYDVMMSCWNAEPE 338 Query: 129 DRPTFAQI 136 RP+FA++ Sbjct: 339 VRPSFAKL 346 >SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 525 Score = 113 bits (273), Expect = 6e-26 Identities = 61/145 (42%), Positives = 85/145 (58%), Gaps = 7/145 (4%) Query: 13 DLAARNILVDSTGVLKVADFGLSR---SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDV 69 DLAARNILV KVADFGL+R Y + P++W APEA + +++ KSDV Sbjct: 379 DLAARNILVGENYACKVADFGLARLIEDDEYNPHQGAKFPIKWTAPEAALFNRFTIKSDV 438 Query: 70 WAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPHD 129 W+F +LL E+ T G PY ++N +V + + G R+PKP AS Y +M+ECW + D Sbjct: 439 WSFGILLSELITYGRIPYPGMTNAEVLSQVERGYRMPKPPNASDSFYAIMLECWKKNEAD 498 Query: 130 RPTF----AQIVDKLVIQQQLYVDL 150 RPTF + + D LV + Y D+ Sbjct: 499 RPTFEYLQSVLEDYLVATEPSYRDV 523 >SB_43850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 109 bits (263), Expect = 1e-24 Identities = 56/168 (33%), Positives = 91/168 (54%), Gaps = 7/168 (4%) Query: 13 DLAARNILVDSTGVLKVADFGLSR----SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLA RN ++ + V+K+ DFG++R S Y R +P+RW+APE+++ + +KSD Sbjct: 1683 DLALRNCMIGAGHVVKLGDFGMTRAMFDSDYYRFGRKGMLPVRWMAPESLMDGVFTTKSD 1742 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPH 128 VW V LWE+ T+G FPY SN +V ++ G + P A + +L+ CW DP+ Sbjct: 1743 VWGLGVTLWELCTMGSFPYQGFSNAEVVTYVQEGNSMDPPQGAQQQFGDLLKSCWLTDPN 1802 Query: 129 DRPTFAQIVDKLVIQQQLY---VDLECVLPPSEEDIGFKDYDYTLPSP 173 +RP +I+D L +L ++ P ++D G +T +P Sbjct: 1803 ERPEPDKIMDLLSDNLELLKPCINCPTASVPRDDDSGGSVATHTPTTP 1850 >SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 478 Score = 105 bits (251), Expect = 3e-23 Identities = 50/116 (43%), Positives = 68/116 (58%), Gaps = 3/116 (2%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGV---YVHTRSKPVPLRWLAPEAIVHSQYCSKSDV 69 DLAARN L+ +KVADFGL+R + Y + P++W APE I++S++ SKSDV Sbjct: 332 DLAARNCLIGENRTVKVADFGLARYVIDDEYTASEGTKFPIKWAAPEVILYSKFSSKSDV 391 Query: 70 WAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSD 125 WAF +L WE+ T G PY +N V + G RL KP+R Y M +CW + Sbjct: 392 WAFGILAWEVYTGGKQPYPATNNTDVVQMVINGYRLEKPLRCPDAAYSTMRKCWHE 447 >SB_16900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 103 bits (247), Expect = 9e-23 Identities = 52/110 (47%), Positives = 66/110 (60%), Gaps = 3/110 (2%) Query: 13 DLAARNILVDSTGVLKVADFGLSR---SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDV 69 DLAARN LV ++KVADFGLSR +Y + P++W APEA+ H+ + KSDV Sbjct: 339 DLAARNCLVGDNNLVKVADFGLSRLVSEDIYTAHQGAKFPIKWTAPEALAHNTFSIKSDV 398 Query: 70 WAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELM 119 WAF +LLWE+AT G PY + QV L GG R+P P +Y LM Sbjct: 399 WAFGILLWELATYGMSPYPGIDLSQVYDKLDGGYRMPCPEGCPPEVYSLM 448 >SB_23400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 103 bits (246), Expect = 1e-22 Identities = 55/132 (41%), Positives = 78/132 (59%), Gaps = 9/132 (6%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRS-------KPVPLRWLAPEAIVHSQYCS 65 DLAARNIL+DS K+ADFG SR S + P++W+A E + H+ + Sbjct: 180 DLAARNILLDSHANPKLADFGFSRDNKASKVLSSGKQDKQRKFPVKWMALELLHHNIFTR 239 Query: 66 KSDVWAFAVLLWEIATLGGFPYAEL-SNYQVPAFLTGGGRLPKPMRASVRLYELMVECWS 124 KSDVW++ V+LWEI TLGG PY + S Y + LT G R+ KP+ LY++M+ CW Sbjct: 240 KSDVWSYGVVLWEIFTLGGSPYPGVPSRYLLKRLLT-GYRMEKPLHCPDELYDVMLSCWE 298 Query: 125 DDPHDRPTFAQI 136 ++P R F ++ Sbjct: 299 EEPIKRIGFPEV 310 >SB_59149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 98.7 bits (235), Expect = 3e-21 Identities = 51/116 (43%), Positives = 72/116 (62%), Gaps = 4/116 (3%) Query: 13 DLAARNILVDSTG-VLKVADFGLSRSGV---YVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 D+AA + S G V ++ DFG+SR + Y +R +P++W APEAI + +Y S SD Sbjct: 352 DIAAGMQYLHSLGFVHRIGDFGMSRDLMICDYYTSRGGRIPVKWTAPEAINYGRYSSASD 411 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWS 124 VW++ VLL+EI +LG PYA L N +V ++ G RLP P +Y LMV+CWS Sbjct: 412 VWSYGVLLFEIWSLGDKPYANLDNNEVVEAVSRGYRLPPPDHCPTMIYRLMVDCWS 467 >SB_52372| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.8e-35) Length = 185 Score = 98.7 bits (235), Expect = 3e-21 Identities = 50/127 (39%), Positives = 69/127 (54%), Gaps = 3/127 (2%) Query: 13 DLAARNILVDSTGVLKVADFGLSR---SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDV 69 DLAARN +V +K+ LS + Y + +PLRW+ EAI H + KSDV Sbjct: 46 DLAARNCMVTKDLQVKIGFLNLSYDLYNAEYYRFNNILIPLRWMPSEAIFHDDFTEKSDV 105 Query: 70 WAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPHD 129 W+F VL WEI +LG PY + S+ +V + RLPKP + +M +CW +P+D Sbjct: 106 WSFGVLAWEIYSLGQIPYTDRSDEEVLKCVKDDLRLPKPDNCPDNMANVMKKCWEPNPND 165 Query: 130 RPTFAQI 136 RP F I Sbjct: 166 RPNFDMI 172 >SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 97.9 bits (233), Expect = 4e-21 Identities = 42/93 (45%), Positives = 60/93 (64%) Query: 48 VPLRWLAPEAIVHSQYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPK 107 +P+RW APEAI + ++ S SDVW++ +LLWEI + G PY N+QV + GG RLP Sbjct: 234 IPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPA 293 Query: 108 PMRASVRLYELMVECWSDDPHDRPTFAQIVDKL 140 PM+ ++ LM++CW + RP FA IV +L Sbjct: 294 PMKCPKVIHNLMLDCWDKEKTSRPKFADIVRRL 326 >SB_42486| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1554 Score = 97.9 bits (233), Expect = 4e-21 Identities = 57/155 (36%), Positives = 81/155 (52%), Gaps = 27/155 (17%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS----GVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLAARN+LV V+KV+DFGL+R +YV S +P++W+A E++ Y KSD Sbjct: 971 DLAARNVLVGPDYVMKVSDFGLARDIYQDDLYVKNTSGLLPVKWMALESLFDRVYTEKSD 1030 Query: 69 V-----------------------WAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRL 105 V W+F +LLWEI TLGG PY L Q+ +L+ G R+ Sbjct: 1031 VLVLVLKRRKATLYALICLYRNILWSFGILLWEIMTLGGTPYPGLPTEQLLDYLSEGQRM 1090 Query: 106 PKPMRASVRLYELMVECWSDDPHDRPTFAQIVDKL 140 +P + +Y +M +CW P RP F + D+L Sbjct: 1091 AQPQNCPLEIYTIMRDCWMQLPEQRPHFNVLADRL 1125 >SB_42225| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 300 Score = 97.5 bits (232), Expect = 6e-21 Identities = 51/140 (36%), Positives = 74/140 (52%), Gaps = 4/140 (2%) Query: 1 MGALGTGPVCPYDLAARNILVDSTGVLKVADFGLSRSGV----YVHTRSKPVPLRWLAPE 56 M L + + DLA RN +V +K+ D L+R G Y +P+P+RW+APE Sbjct: 149 MNYLSSNNIVHGDLATRNCMVGPGRTVKITDVALTRLGYSHDYYRQLHRRPLPVRWMAPE 208 Query: 57 AIVHSQYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLY 116 AI+ ++ ++D+W+F VLLWE+ + G P+ SN V L LP P+ +Y Sbjct: 209 AILSYRFTPETDIWSFGVLLWELFSYGAQPHFGFSNEDVMFRLRECILLPCPVDCPASVY 268 Query: 117 ELMVECWSDDPHDRPTFAQI 136 LM ECW P RP F+ I Sbjct: 269 RLMKECWDILPPSRPRFSTI 288 >SB_8553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 982 Score = 95.9 bits (228), Expect = 2e-20 Identities = 41/108 (37%), Positives = 69/108 (63%), Gaps = 5/108 (4%) Query: 48 VPLRWLAPEAIVHSQYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPK 107 +P++W+A EA+ Y ++SDVWA+ +L+WEI T GG PY + +++ L G R+ + Sbjct: 714 LPVKWMALEALFDRVYTAQSDVWAYGILMWEIVTFGGSPYPGIPLWKLFELLKEGYRMEQ 773 Query: 108 PMRASVRLYELMVECWSDDPHDRPTFAQIVDKL-----VIQQQLYVDL 150 P+ +Y LM+ CW ++P+ RPTFA+IV ++ + +Q Y+DL Sbjct: 774 PVNCQDDVYALMLRCWHENPNQRPTFAEIVKEMDAKLTALSEQEYLDL 821 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/24 (66%), Positives = 20/24 (83%) Query: 13 DLAARNILVDSTGVLKVADFGLSR 36 DLAARN+LV V+K+ADFGL+R Sbjct: 605 DLAARNVLVSDNHVIKIADFGLAR 628 >SB_11148| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 196 Score = 95.5 bits (227), Expect = 2e-20 Identities = 49/100 (49%), Positives = 64/100 (64%), Gaps = 4/100 (4%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGV----YVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLAARN+LV V+K+ADFGL+R YV T + +P++W+A EA+V Y SD Sbjct: 90 DLAARNVLVGENYVMKIADFGLARDIYKEEHYVKTTAGLLPVKWMAIEALVDQVYTHSSD 149 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKP 108 VW+F VLLWEI TLGG PY L +V +L G R+ +P Sbjct: 150 VWSFGVLLWEIFTLGGSPYPGLPANEVYQYLMEGQRMAQP 189 >SB_35913| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1176 Score = 90.2 bits (214), Expect = 9e-19 Identities = 41/70 (58%), Positives = 51/70 (72%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDVWAF 72 DLAARNILV VLK++DFGLSR GVYV + +PLRWL+ EA+ Y + SD+WAF Sbjct: 1106 DLAARNILVGEEKVLKISDFGLSREGVYVKRSTGKIPLRWLSIEAMRDRTYSTASDIWAF 1165 Query: 73 AVLLWEIATL 82 ++LWEI TL Sbjct: 1166 GIVLWEICTL 1175 >SB_10779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 90.2 bits (214), Expect = 9e-19 Identities = 41/133 (30%), Positives = 73/133 (54%), Gaps = 6/133 (4%) Query: 14 LAARNILVDSTGVLKVADFGLSRSGV---YVHTRS---KPVPLRWLAPEAIVHSQYCSKS 67 L ++ ++ ++K+A+ G+S +G Y H + P+RWL E I + + + Sbjct: 756 LCTKSCIISKNMIVKIANLGVSDAGPNTSYYHLNTIQKSKYPVRWLPLETIHNGIFDDNT 815 Query: 68 DVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDP 127 D+W++ ++LWE+ + G PY ++N +V + + G LPKP +Y LM +CWS P Sbjct: 816 DIWSYGIMLWEVYSYGMTPYYGMNNEEVISLVRDGDILPKPKECPREMYSLMQDCWSLVP 875 Query: 128 HDRPTFAQIVDKL 140 H+RP F + K+ Sbjct: 876 HERPRFRYLHQKI 888 >SB_31555| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1063 Score = 86.2 bits (204), Expect = 1e-17 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 4/91 (4%) Query: 13 DLAARNILVDSTGVLKVADFGLSR----SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLA RN LV + V+K+ADFG+SR S Y +R +P+RWLAPEA ++ ++ KSD Sbjct: 969 DLATRNCLVGTDMVVKIADFGMSRDVYGSDYYKMSRETMLPIRWLAPEAFLYGKFTVKSD 1028 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQVPAFL 99 V+++ VLLWEI T G PY +N +V F+ Sbjct: 1029 VYSYGVLLWEIFTFGLQPYYGYTNKEVTEFI 1059 >SB_28925| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 792 Score = 86.2 bits (204), Expect = 1e-17 Identities = 52/136 (38%), Positives = 70/136 (51%), Gaps = 23/136 (16%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS--------GVYVHTRSKPVPLRWLAPEAIVHSQYC 64 DLAARNILV KV+DFGLSR T+ +P+RW APEAI + ++ Sbjct: 569 DLAARNILVSENMTTKVSDFGLSRELDDLSDNPDSEYQTQGGKIPVRWTAPEAIKYRKFS 628 Query: 65 SKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWS 124 S SDVW++ +LLWEI + PY N+Q PK ++ LM++CW Sbjct: 629 SASDVWSYGILLWEIMSFSERPYWGWDNFQ---------NCPK------IVHNLMLDCWH 673 Query: 125 DDPHDRPTFAQIVDKL 140 D RP F IV ++ Sbjct: 674 KDKCKRPKFVDIVQRI 689 >SB_28361| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 551 Score = 85.0 bits (201), Expect = 3e-17 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 4/105 (3%) Query: 8 PVCPYDLAARNILVDSTGVLKVADFGLSRS----GVYVHTRSKPVPLRWLAPEAIVHSQY 63 PV DLAARN+LV + K+ DFGL+R+ +Y T +P++W A E++++ Sbjct: 440 PVIHRDLAARNVLVGEGQMCKITDFGLARNVHNDNIYTRTSRGRLPVKWTAYESLLYGTC 499 Query: 64 CSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKP 108 + SDVW++ V+L+EI T+GG PY V L G R+PKP Sbjct: 500 TTMSDVWSYGVVLYEIFTIGGSPYPGKDGKAVVELLQDGYRMPKP 544 >SB_19226| Best HMM Match : I-set (HMM E-Value=0) Length = 1500 Score = 84.2 bits (199), Expect = 6e-17 Identities = 45/137 (32%), Positives = 74/137 (54%), Gaps = 4/137 (2%) Query: 27 LKVADFGLSRS---GVYVHT-RSKPVPLRWLAPEAIVHSQYCSKSDVWAFAVLLWEIATL 82 +KV D LSR G Y ++ P++W+A E++ ++Y SDVW++ VLLWE+ TL Sbjct: 8 VKVTDCALSRDLFPGDYCCLCDNENRPVKWMAVESLESNRYTVSSDVWSYGVLLWELMTL 67 Query: 83 GGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPHDRPTFAQIVDKLVI 142 PYA + +++ FL G R+ +P+ L+ ++ CW+ DRP+F Q++ L Sbjct: 68 ALQPYANIDAFEMLNFLKKGHRIAQPVNCPDELFTVIACCWALSEDDRPSFGQLIASLRT 127 Query: 143 QQQLYVDLECVLPPSEE 159 L L +L + E Sbjct: 128 SSALKQGLPMILCANHE 144 >SB_39694| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 893 Score = 82.6 bits (195), Expect = 2e-16 Identities = 42/120 (35%), Positives = 59/120 (49%), Gaps = 2/120 (1%) Query: 22 DSTGVLKVADFGLSRSGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDVWAFAVLLWEIAT 81 D +LK+ DFGL+R S W+APE I + + SDVW++ V+LWE+ T Sbjct: 224 DFNNILKITDFGLAREIANTTRMSAAGTYAWMAPEVIRTNTFSFASDVWSYGVVLWELLT 283 Query: 82 LGGFPYAELSNYQVP-AFLTGGGRLPKPMRASVRLYELMVECWSDDPHDRPTFAQIVDKL 140 G PY ++ V LP P LM +CW+ DPH RPTF +++ L Sbjct: 284 -GQVPYKDVEALAVAYGVAMNSLTLPIPTTCPEVFKNLMADCWNQDPHKRPTFKAVLEAL 342 >SB_6592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 82.6 bits (195), Expect = 2e-16 Identities = 39/83 (46%), Positives = 52/83 (62%), Gaps = 1/83 (1%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDVWAF 72 DLAARNILV ++K++DFGLSR Y T P RW APE + ++ +KSDVW+F Sbjct: 986 DLAARNILVVKENLVKISDFGLSRLSQYYKTDKGKFPTRWYAPECLEFLKFTAKSDVWSF 1045 Query: 73 AVLLWEIATLGGF-PYAELSNYQ 94 V +WE+ GG PY E+ + Q Sbjct: 1046 GVTMWEMFEYGGARPYQEIEDAQ 1068 >SB_21044| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1507 Score = 81.8 bits (193), Expect = 3e-16 Identities = 41/88 (46%), Positives = 58/88 (65%), Gaps = 5/88 (5%) Query: 13 DLAARNILVDSTGVLKVADFGLSR---SGVYVHTRSKPV-PLRWLAPEAIVHSQYCSKSD 68 DLA RN LV + +K+ADFG+SR S Y + + + P+RW+APE I+ ++ S SD Sbjct: 370 DLATRNCLVGHSFTVKIADFGMSRHLYSKHYYRIQGRVILPIRWMAPECILQGKFTSASD 429 Query: 69 VWAFAVLLWEIATLGG-FPYAELSNYQV 95 VWAF V LWEI TL +PY +L++ +V Sbjct: 430 VWAFGVTLWEILTLAAEYPYGDLTDEKV 457 >SB_40820| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 526 Score = 79.0 bits (186), Expect = 2e-15 Identities = 47/153 (30%), Positives = 74/153 (48%), Gaps = 26/153 (16%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLRWLAPEAIVHS----------- 61 DLAARN+L+ G KV+DFGL+R + K P++W APEA+ Sbjct: 367 DLAARNVLIHEDGTAKVSDFGLARDADVIVEGGK-FPIKWTAPEALKEQSSRIRTPNRRS 425 Query: 62 --------------QYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPK 107 ++ +KSDVW++ + +WE+ + G PY + V A + G R+ Sbjct: 426 RLFKLYYTNPNRRDKFSTKSDVWSYGIFMWELFSFGRVPYPRVPLSDVVAKVEKGYRMES 485 Query: 108 PMRASVRLYELMVECWSDDPHDRPTFAQIVDKL 140 P +Y++M + W +P+ RPTF I +L Sbjct: 486 PDGCPPEVYQIMRDSWEMNPNARPTFGDIHRRL 518 >SB_19482| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-11) Length = 431 Score = 76.6 bits (180), Expect = 1e-14 Identities = 52/142 (36%), Positives = 76/142 (53%), Gaps = 19/142 (13%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGV---YVHTRSKP--VPLRWLAPEAIVHSQYCSKS 67 DLAARN +V S +K+ DFG+SRS Y + P VPLRWLAP++ ++ + Sbjct: 65 DLAARNCIVASDLSVKIGDFGISRSLYKEDYYKIPNSPEFVPLRWLAPDSTQYNPDSGLT 124 Query: 68 --------DVWAFAVLLWEIATLGGFPYAELSNYQV--PAFLTGGGRLPKPM---RASVR 114 +VW+F V LWE+ G PY +L++ V + +LP+P RA Sbjct: 125 VNPPSEMGNVWSFGVTLWEVVEFGRLPYEDLTDDDVIQTVLVDQLYQLPEPKQTGRAQTL 184 Query: 115 LYELMVECWSDDPHDRPTFAQI 136 LYE+M +CW+ DP+ R T + Sbjct: 185 LYEVMRKCWA-DPNKRLTIRNV 205 >SB_7022| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.2e-08) Length = 108 Score = 75.8 bits (178), Expect = 2e-14 Identities = 36/98 (36%), Positives = 56/98 (57%), Gaps = 2/98 (2%) Query: 54 APEAIVHSQYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTG-GGRLPKPMRAS 112 APE+I + + KSDVW++ V LWE+ + G PY E++ +V L G RL +P Sbjct: 3 APESINYGTFSHKSDVWSYGVTLWEMYSFGQLPYGEMTGGEVIKMLENEGKRLDRPDACP 62 Query: 113 VRLYELMVECWSDDPHDRPTFAQIVDKLVIQQQLYVDL 150 +Y+LM++CW P +RPTF ++ + LY D+ Sbjct: 63 EYVYKLMLKCWDLSPENRPTFNEL-HNIFSTDPLYADV 99 >SB_289| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.5e-32) Length = 773 Score = 75.4 bits (177), Expect = 3e-14 Identities = 33/88 (37%), Positives = 55/88 (62%) Query: 53 LAPEAIVHSQYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRAS 112 ++ +AI + ++ + SDVW++ +LLWE + PY + SN++V + G RLP PM Sbjct: 542 VSKKAIKYRKFSTSSDVWSYGILLWETFSFAERPYWDWSNFEVMDRVETGYRLPPPMSCP 601 Query: 113 VRLYELMVECWSDDPHDRPTFAQIVDKL 140 ++++M+ECW D RP+FA IV +L Sbjct: 602 KVIHQIMLECWDADRTKRPSFALIVKQL 629 >SB_53713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 74.9 bits (176), Expect = 4e-14 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 5/80 (6%) Query: 13 DLAARNILVDSTGVLKVADFGLSR----SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLAARN+L+D KV+DFGLSR + VY T +P +W+A E+I Y S SD Sbjct: 759 DLAARNVLLDEALTAKVSDFGLSRDIYTNSVYEKTTGGKLPAKWMAIESIEAGLYTSHSD 818 Query: 69 VWAFAVLLWEIAT-LGGFPY 87 W+F VLLWEI T FPY Sbjct: 819 AWSFGVLLWEIETGARWFPY 838 >SB_9759| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 387 Score = 73.3 bits (172), Expect = 1e-13 Identities = 37/91 (40%), Positives = 55/91 (60%), Gaps = 4/91 (4%) Query: 13 DLAARNILVDSTGVLKVADFGLSR----SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLA RN LV V+K+ADFG+SR S Y +P+RW+ PEA+++ ++ +SD Sbjct: 91 DLATRNCLVGDGLVVKIADFGMSRDVYASDYYKVEGQAVMPIRWMPPEALLYGRFTVESD 150 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQVPAFL 99 V++F VLLWE+ PY +N +V F+ Sbjct: 151 VYSFGVLLWEVYAFALQPYYGYTNEEVCGFI 181 Score = 73.3 bits (172), Expect = 1e-13 Identities = 37/91 (40%), Positives = 55/91 (60%), Gaps = 4/91 (4%) Query: 13 DLAARNILVDSTGVLKVADFGLSR----SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLA RN LV V+K+ADFG+SR S Y +P+RW+ PEA+++ ++ +SD Sbjct: 274 DLATRNCLVGDGLVVKIADFGMSRDVYASDYYKVEGQAVMPIRWMPPEALLYGRFTVESD 333 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQVPAFL 99 V++F VLLWE+ PY +N +V F+ Sbjct: 334 VYSFGVLLWEVYAFALQPYYGYTNEEVCGFI 364 >SB_46968| Best HMM Match : Pkinase_Tyr (HMM E-Value=8e-08) Length = 143 Score = 71.7 bits (168), Expect = 3e-13 Identities = 38/98 (38%), Positives = 55/98 (56%), Gaps = 2/98 (2%) Query: 70 WAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPHD 129 W++ VLLWE+ + G PYA +S ++ L G RL KP S LY +M ECW+ +P + Sbjct: 34 WSYGVLLWEMESGGLMPYAGMSGVEILERLKQGYRLEKPSCCSQELYAIMYECWNPEPKN 93 Query: 130 RPTFAQIVDKLVIQQQLYVDLECVLPPSEEDIGFKDYD 167 RP+F+ IV +L + E +LP E+ G YD Sbjct: 94 RPSFSDIVHRLEEILRGKAGYEEILP--EDGKGETPYD 129 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 65.3 bits (152), Expect = 3e-11 Identities = 32/85 (37%), Positives = 50/85 (58%), Gaps = 6/85 (7%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGV-----YVHTRSKPVPLRWLAPEAIVHSQYCSKS 67 DLAARN + ++K+++ G+ +VH S +P+RW+ PEA+ + +S Sbjct: 277 DLAARNCFITEDNIVKISNLGIGSCRYPADYSWVHGSSL-LPVRWMPPEALNSLHFTHRS 335 Query: 68 DVWAFAVLLWEIATLGGFPYAELSN 92 DVW+F V+LWEI + G PY+ L N Sbjct: 336 DVWSFGVVLWEIYSYGRQPYSGLRN 360 >SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1427 Score = 63.3 bits (147), Expect = 1e-10 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 5/88 (5%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS-----GVYVHTRSKPVPLRWLAPEAIVHSQYCSKS 67 DLAARN+L++S +K+ DFGL R+ Y VP W PEA+ + ++ S Sbjct: 291 DLAARNVLLESNEKVKIGDFGLMRALSVEDDYYTMNPKGKVPFAWCPPEALKYRKFSHAS 350 Query: 68 DVWAFAVLLWEIATLGGFPYAELSNYQV 95 DVW+F + + E+ + G P+ L+ QV Sbjct: 351 DVWSFGICVIELFSYGEEPWPGLNGAQV 378 >SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 61.3 bits (142), Expect = 5e-10 Identities = 44/131 (33%), Positives = 68/131 (51%), Gaps = 11/131 (8%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKP-----VPLRWLAPEAIVHSQYCSKS 67 D+ A N+L+ TG +K+ADFG++ G T +K P W+APE I S Y SK+ Sbjct: 932 DIKAANVLMSETGDVKLADFGVA--GQLTDTLNKRNTFVGTPF-WMAPEVIKQSAYDSKA 988 Query: 68 DVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPK-PMRASVRLYELMVECWSDD 126 D+W+ + E+A G P ++L +V FL P+ S E + C + D Sbjct: 989 DIWSLGITAIELAK-GEPPNSDLHPMRV-LFLIPKNNPPELTGNFSKAFKEFVSLCLNKD 1046 Query: 127 PHDRPTFAQIV 137 P+DRPT +++ Sbjct: 1047 PNDRPTAKELL 1057 >SB_22969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 817 Score = 57.6 bits (133), Expect = 6e-09 Identities = 23/60 (38%), Positives = 35/60 (58%) Query: 86 PYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPHDRPTFAQIVDKLVIQQQ 145 PY + N +P L G R+PKP+ LY +M+ CW +DP +RPTF ++ D + Q+ Sbjct: 690 PYPGVGNNYIPRMLREGYRMPKPLHVGDALYCVMLRCWQEDPDERPTFDELRDNMQTLQR 749 >SB_12642| Best HMM Match : Pkinase (HMM E-Value=5.3e-07) Length = 253 Score = 57.2 bits (132), Expect = 8e-09 Identities = 42/126 (33%), Positives = 65/126 (51%), Gaps = 11/126 (8%) Query: 18 NILVDSTGVLKVADFGLSRSGVYVHTRSKP-----VPLRWLAPEAIVHSQYCSKSDVWAF 72 N+L+ TG +K+ADFG++ G T +K P W+APE I S Y SK+D+W+ Sbjct: 3 NVLMSETGDVKLADFGVA--GQLTDTLNKRNTFVGTPF-WMAPEVIKQSAYDSKADIWSL 59 Query: 73 AVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPK-PMRASVRLYELMVECWSDDPHDRP 131 + E+A G P ++L +V FL P+ S E + C + DP+DRP Sbjct: 60 GITAIELAK-GEPPNSDLHPMRV-LFLIPKNNPPELTGNFSKAFKEFVSLCLNKDPNDRP 117 Query: 132 TFAQIV 137 T +++ Sbjct: 118 TAKELL 123 >SB_37607| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-23) Length = 267 Score = 55.6 bits (128), Expect = 2e-08 Identities = 30/61 (49%), Positives = 40/61 (65%), Gaps = 4/61 (6%) Query: 13 DLAARNILVDSTGVLKVADFGLSR----SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLAARNIL++ V V+DFGLSR SG Y +T +P+RW+A E++ Y +KSD Sbjct: 207 DLAARNILLNVDNVAMVSDFGLSRDVYESGAYDNTTGGVLPVRWMAIESLEDYTYTTKSD 266 Query: 69 V 69 V Sbjct: 267 V 267 >SB_26337| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-21) Length = 602 Score = 55.6 bits (128), Expect = 2e-08 Identities = 30/61 (49%), Positives = 40/61 (65%), Gaps = 4/61 (6%) Query: 13 DLAARNILVDSTGVLKVADFGLSR----SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLAARNIL++ V V+DFGLSR SG Y +T +P+RW+A E++ Y +KSD Sbjct: 542 DLAARNILLNVDNVAMVSDFGLSRDVYESGAYDNTTGGVLPVRWMAIESLEDYTYTTKSD 601 Query: 69 V 69 V Sbjct: 602 V 602 >SB_43991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 55.2 bits (127), Expect = 3e-08 Identities = 49/141 (34%), Positives = 75/141 (53%), Gaps = 20/141 (14%) Query: 13 DLAARNILVDSTGVLKVADFGLS--RSGVYVHT-RSKPVPLRWLAPEAI-VHSQY---CS 65 +L + N LVDS VLK+ D+GL RS T + L W+APE + + S+ Sbjct: 650 NLKSSNCLVDSRWVLKITDYGLPLLRSRSKKSTIETNWRDLLWVAPEILRIPSRPPKGTH 709 Query: 66 KSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGR---LP--KPMRASV-----RL 115 K DV++F+++L E T G PY+ +NY P + R P +P+ A++ L Sbjct: 710 KGDVYSFSIILQEFHTRDG-PYS--ANYMEPKAIIEKVRKSEFPPYRPIVANLIDGAEEL 766 Query: 116 YELMVECWSDDPHDRPTFAQI 136 +LM +CW++DP RP F +I Sbjct: 767 RDLMKQCWAEDPDLRPDFTEI 787 >SB_13537| Best HMM Match : Pkinase (HMM E-Value=4e-11) Length = 253 Score = 55.2 bits (127), Expect = 3e-08 Identities = 51/171 (29%), Positives = 86/171 (50%), Gaps = 19/171 (11%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLR-WLAPEAIVHSQ----YCSKS 67 D+ NIL+D G +K+ DFG+S V +++ + ++APE I S Y +S Sbjct: 82 DVKPSNILLDRNGAIKLCDFGISGHLVDSIAKTRDAGCKPYMAPERIDPSSCRQGYDIRS 141 Query: 68 DVWAFAVLLWEIATLGGFPYAELSNY--QVPAFLTGG----GRLPKPMRASVRLYELMVE 121 DVW+F + + E++T G FPY + ++ Q+ + G P+ MR S L + Sbjct: 142 DVWSFGITMIELST-GVFPYPKWNSVFDQLSQVVDGDPPQLSNTPEMMR-SPELLNFVNI 199 Query: 122 CWSDDPHDRPTFAQIVDKLVIQ--QQLYVD----LECVLPPSEEDIGFKDY 166 C S + RP + ++++ IQ Q+ VD L+ VL + ED F ++ Sbjct: 200 CLSKEVEKRPKYNELLNHQFIQLYQERPVDVGAWLQEVLALAPEDPDFTEH 250 >SB_41626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 55.2 bits (127), Expect = 3e-08 Identities = 30/72 (41%), Positives = 42/72 (58%), Gaps = 4/72 (5%) Query: 13 DLAARNILVDSTGVLKVADFGLSR----SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLAARN+L+ VLKVADFGL+R + YV VP++W+A E++ Y KSD Sbjct: 562 DLAARNVLIADDYVLKVADFGLARDVYKNEEYVKHTPGLVPIKWIAIESLTDKIYSQKSD 621 Query: 69 VWAFAVLLWEIA 80 V+ W ++ Sbjct: 622 VYNIMTDCWVLS 633 Score = 37.5 bits (83), Expect = 0.007 Identities = 13/26 (50%), Positives = 18/26 (69%) Query: 115 LYELMVECWSDDPHDRPTFAQIVDKL 140 +Y +M +CW P DRPTF ++V KL Sbjct: 622 VYNIMTDCWVLSPEDRPTFTELVKKL 647 >SB_11943| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 591 Score = 54.8 bits (126), Expect = 4e-08 Identities = 30/63 (47%), Positives = 43/63 (68%), Gaps = 7/63 (11%) Query: 13 DLAARNILVDSTGVLKVADFGLSR----SGVY--VHTRSKPVPLRWLAPEAIVHSQYCSK 66 DLAARNIL+ ++K++DFGL+R S Y +H K +PL+W+APEAI + + +K Sbjct: 530 DLAARNILICEDNLVKISDFGLTRDVYESSEYHKMHNTGK-LPLKWMAPEAIFQNVHTTK 588 Query: 67 SDV 69 SDV Sbjct: 589 SDV 591 >SB_57129| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 456 Score = 54.8 bits (126), Expect = 4e-08 Identities = 39/97 (40%), Positives = 53/97 (54%), Gaps = 9/97 (9%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLRWL-APEAIVHSQYCSKSDVWA 71 DLAARN+L+ + GV KVADFGLSR+ K L ++ P+ +H W+ Sbjct: 228 DLAARNVLI-ADGVAKVADFGLSRNIYETGEYEKTTRLCFIYRPQNWLHFS-------WS 279 Query: 72 FAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKP 108 + VLLWEI T G P A L+ ++ A G RL +P Sbjct: 280 YGVLLWEIETRGLTPNAGLNYREMIARYRKGYRLERP 316 >SB_43870| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 869 Score = 54.4 bits (125), Expect = 5e-08 Identities = 29/69 (42%), Positives = 40/69 (57%), Gaps = 4/69 (5%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS----GVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLAARNILV +LK+ADFGL+R Y T +P++W+A EA+ Y ++SD Sbjct: 541 DLAARNILVADDNILKIADFGLARDVHNVDYYRKTTDGRLPVKWMAFEALFDRVYTTQSD 600 Query: 69 VWAFAVLLW 77 V+ W Sbjct: 601 VYEIMRNCW 609 Score = 35.1 bits (77), Expect = 0.035 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 5/42 (11%) Query: 115 LYELMVECWSDDPHDRPTFAQIV---DKLV--IQQQLYVDLE 151 +YE+M CW+++P RPTF +V D LV + + Y++L+ Sbjct: 601 VYEIMRNCWNENPEARPTFTSLVQAFDDLVALLSDEEYLELQ 642 >SB_42680| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 700 Score = 54.0 bits (124), Expect = 7e-08 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Query: 13 DLAARNILVDSTGVLKVADFGLSR---SGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DLAARN+LV V KVADFGL+R +Y S+ +PL+W++ EAI + S+SD Sbjct: 641 DLAARNVLVGDNKVAKVADFGLTRHMYEDLYQGKTSRKLPLKWMSIEAIFDQAFTSQSD 699 >SB_51259| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.4e-08) Length = 181 Score = 54.0 bits (124), Expect = 7e-08 Identities = 37/133 (27%), Positives = 59/133 (44%), Gaps = 7/133 (5%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDVWAF 72 D+ +N+LVD + DFGL ++ + P +APE +V Y DV+AF Sbjct: 41 DVKLQNVLVDEKSQGSLTDFGLCKAEGVMENSLVGTPTS-MAPE-MVKQNYNKSVDVYAF 98 Query: 73 AVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLP--KPMRASVRL---YELMVECWSDDP 127 +L+W + G ++ + +P + L KP R + + LM CW+ P Sbjct: 99 GILMWRVCEGQGNQPRNIALHPIPIIMLVRNALEDRKPERLDRFMGPCWNLMERCWATVP 158 Query: 128 HDRPTFAQIVDKL 140 RP F +I L Sbjct: 159 DQRPNFQEIESDL 171 >SB_21166| Best HMM Match : Pkinase (HMM E-Value=0) Length = 282 Score = 53.2 bits (122), Expect = 1e-07 Identities = 41/132 (31%), Positives = 59/132 (44%), Gaps = 10/132 (7%) Query: 13 DLAARNILVDSTGVLKVADFGLSR---SGVYVHTRSKPV-PLRWLAPEAIVHSQYCSKSD 68 DL N+L+ G K+ DFG + TRS + APE + ++D Sbjct: 144 DLKPANVLIADDGSCKIGDFGCCQFVDDQPNTPTRSYLTGTFAYRAPELLRGESPTFQAD 203 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGG----GRLPKPMRASVRLYELMVECWS 124 V++FA+ +W+I T PY +L N+QV F ++P R ELM W+ Sbjct: 204 VYSFAICMWQIWTRE-VPY-KLQNHQVVIFRVVACSLRPQIPTGNEIDNRYKELMTSAWA 261 Query: 125 DDPHDRPTFAQI 136 P DRPT I Sbjct: 262 GKPTDRPTMGDI 273 >SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 52.4 bits (120), Expect = 2e-07 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 6/86 (6%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS-GVYVHTRSKPVPLRWL-APEAIVHSQ-YCSKSDV 69 DL +N+L+D G +K+ADFGL+R+ GV V + + V W APE ++ S+ Y + DV Sbjct: 93 DLKPQNLLIDKNGAIKLADFGLARAFGVPVRSYTHEVVTLWYRAPEILLGSRYYATPVDV 152 Query: 70 WAFAVLLWEIAT---LGGFPYAELSN 92 W+ + E+ T +G Y E +N Sbjct: 153 WSIGCIFAEMYTEHWIGPPSYGERNN 178 >SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 52.0 bits (119), Expect = 3e-07 Identities = 28/72 (38%), Positives = 42/72 (58%), Gaps = 3/72 (4%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS-GVYVHTRSKPVPLRWL-APEAIVHSQ-YCSKSDV 69 DL +N+L+DS G++K+ADFGL R+ G+ V + V W APE ++ Q Y DV Sbjct: 234 DLKPQNLLIDSKGLIKLADFGLGRAFGIPVRAYTHEVVTLWYRAPEVLLGGQRYSCPIDV 293 Query: 70 WAFAVLLWEIAT 81 W+ + E+ T Sbjct: 294 WSIGTIFAEMVT 305 >SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) Length = 1850 Score = 51.2 bits (117), Expect = 5e-07 Identities = 28/109 (25%), Positives = 57/109 (52%), Gaps = 6/109 (5%) Query: 42 HTRSKPVPLRWLAPEAIVHSQYCSKSDVWAFAVLLWEIATLGGFPYAE------LSNYQV 95 + +K +R APE+++ ++ SD+W++ VL++++ TLG PY+ ++ QV Sbjct: 672 YVSNKSTQVRHDAPESLLDGRFSCASDMWSYGVLMYQVFTLGVTPYSRGNGRGCDTDEQV 731 Query: 96 PAFLTGGGRLPKPMRASVRLYELMVECWSDDPHDRPTFAQIVDKLVIQQ 144 ++ GG+L ++ L+ C D +RPT ++ ++L Q Sbjct: 732 RQYVLKGGKLLSEACIPKQIAALIERCTEFDSRERPTAEEVENELEAYQ 780 Score = 37.9 bits (84), Expect = 0.005 Identities = 34/135 (25%), Positives = 56/135 (41%), Gaps = 6/135 (4%) Query: 46 KPVPL---RWLAPEAIVHSQYCSKSDVWAFAVLLWEIA-TLGGFPYAELSNYQVPAFLTG 101 KP+P+ W APE + Y +DV++F + +E+ TL + + + Sbjct: 1101 KPMPIDDSAWSAPEVKNDNYYSQAADVYSFGKVAFEMFNTLDELEASAAAAMDDLTKSSF 1160 Query: 102 GGRLP-KPMRASVRLYELMVECWSDDPHDRPTFAQIVDKLVIQQQLYVDLECVLPPSEED 160 G P +P LY + +C P +RPTF +VD L ++ + D Sbjct: 1161 EGNYPVQPQSMPCWLYITLKQCLLHYPRERPTFLLLVDTLTSRKPFDSWMLKHWKKIHND 1220 Query: 161 IGFKDYDYTLPSPLP 175 + D+D T P P Sbjct: 1221 VNV-DFDVTQPENAP 1234 >SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) Length = 964 Score = 51.2 bits (117), Expect = 5e-07 Identities = 46/149 (30%), Positives = 75/149 (50%), Gaps = 15/149 (10%) Query: 7 GPVCPYDLAARNILVDSTG-VLKVADFGLSRSGVYVHTRSKPVPLR----WLAPEAIVHS 61 G + DL +NIL++ V+K+ DFG+S+ + ++SK + +++PE Sbjct: 122 GQILHRDLKTQNILLNKKRKVVKIGDFGISK---ILSSKSKANTVIGSPCYISPELCEGK 178 Query: 62 QYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAF---LTGGGRLPKPMRASVRLYEL 118 Y KSDVW+ +L+E+ TL E SN +PA + G P P R S L +L Sbjct: 179 PYNQKSDVWSLGCVLYELTTLK--RAFEASN--LPALVLKIMRGYFSPIPERYSEELRKL 234 Query: 119 MVECWSDDPHDRPTFAQIVDKLVIQQQLY 147 +++ DP RP +I+ + VI L+ Sbjct: 235 ILDMLVLDPTKRPGIKEIMAQPVIVNALF 263 >SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) Length = 1123 Score = 50.8 bits (116), Expect = 7e-07 Identities = 39/131 (29%), Positives = 61/131 (46%), Gaps = 8/131 (6%) Query: 13 DLAARNILVDSTGVLKVADFGLSR--SGVYVHTRSKPVPLRWLAPEAIVHSQY-C--SKS 67 DL +NI + V+K+ DFG++R H R+ +L+PE Y C +KS Sbjct: 86 DLKTQNIFLTKDDVVKIGDFGIARILDSTCDHARTTVGTPYYLSPEICQRQPYPCYNNKS 145 Query: 68 DVWAFAVLLWEIAT-LGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDD 126 D+WA +L+E+ T F L+N V + G P P L +L+ + Sbjct: 146 DIWALGCVLYELTTRTHPFTADNLTNLVVK--ILHGNYPPIPRFYGPLLEDLVAVMLKIN 203 Query: 127 PHDRPTFAQIV 137 P DRP+ Q++ Sbjct: 204 PADRPSAKQLI 214 >SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) Length = 226 Score = 50.4 bits (115), Expect = 9e-07 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 5/79 (6%) Query: 4 LGTGPVCPYDLAARNILVDSTGVLKVADFGLSRSGVY---VHTRSKPVPLRWLAPEAIVH 60 L T + D+ +NILV G +K+ADFGL+R VY + S V L + APE ++ Sbjct: 129 LHTHRIVHRDIKPQNILVTKDGQVKIADFGLAR--VYKDAMALTSVVVTLWYRAPEVLLQ 186 Query: 61 SQYCSKSDVWAFAVLLWEI 79 S Y + D+W+ A +L E+ Sbjct: 187 SSYATSVDIWSVACILAEL 205 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 48.0 bits (109), Expect = 5e-06 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 2/69 (2%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVH--TRSKPVPLRWLAPEAIVHSQYCSKSDVW 70 DL N+++DS G +K+ADFG+ + ++ + TR+ ++APE + + Y D W Sbjct: 2 DLKLDNVMLDSDGHIKIADFGMCKESMFNNQTTRTFCGTPDYIAPEIVAYQPYGFSVDWW 61 Query: 71 AFAVLLWEI 79 A VL++E+ Sbjct: 62 ALGVLIYEM 70 >SB_9978| Best HMM Match : Pkinase (HMM E-Value=3.4e-17) Length = 348 Score = 46.8 bits (106), Expect = 1e-05 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 2/69 (2%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS--GVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDVW 70 DL N+L+DS G +K+ADFGL + G T + +LAPE + + Y D W Sbjct: 276 DLKLDNLLLDSEGYVKIADFGLCKEDMGYGARTGTFCGTPEFLAPEVLTETSYTRAVDWW 335 Query: 71 AFAVLLWEI 79 VL++E+ Sbjct: 336 GLGVLIFEM 344 >SB_37572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 46.4 bits (105), Expect = 1e-05 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 10/84 (11%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPL---RWLAPEAIVHSQ----YCS 65 D+ NILVD G K+ DFG+ SG V + +K V ++APE I + Y Sbjct: 154 DVKPSNILVDERGNFKLCDFGI--SGQLVDSLAKTVDAGCKPYMAPERINPDRDMKGYDI 211 Query: 66 KSDVWAFAVLLWEIATLGGFPYAE 89 +SD+W+ + + E+AT G FPY + Sbjct: 212 RSDIWSLGITMIELAT-GKFPYTQ 234 >SB_24478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 747 Score = 46.4 bits (105), Expect = 1e-05 Identities = 38/133 (28%), Positives = 55/133 (41%), Gaps = 6/133 (4%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDVWAF 72 D+ +N+L+DS K+ D G + + P+ +APE + Y + DV+A Sbjct: 590 DIKLKNVLLDSKNRGKITDLGFCKPEAMMSGSIVGTPIH-MAPE-LFSGHYDNSVDVYAL 647 Query: 73 AVLLWEI-ATLGGFPYAELSNYQVPAFLTGGGRLPKPMRAS---VRLYELMVECWSDDPH 128 +LLW I A P A R +P R + + LM CWS DP Sbjct: 648 GILLWYICAGTVRLPLAFEQCASKDHLWNAVRRGVRPERLANFDEECWMLMEACWSGDPS 707 Query: 129 DRPTFAQIVDKLV 141 RP I +LV Sbjct: 708 ARPLLGDIQPQLV 720 >SB_51157| Best HMM Match : Pkinase (HMM E-Value=0.00029) Length = 161 Score = 45.6 bits (103), Expect = 2e-05 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 10/79 (12%) Query: 18 NILVDSTGVLKVADFGLSRSGVYVHTRSKPVPL---RWLAPEAIVHSQ----YCSKSDVW 70 NILVD +G K+ DFG+ SG V + +K V ++APE I + Y +SD+W Sbjct: 6 NILVDESGNFKLCDFGI--SGQLVDSLAKTVDAGCKPYMAPERINPDRDMKGYDIRSDIW 63 Query: 71 AFAVLLWEIATLGGFPYAE 89 + + + E+AT G FPY + Sbjct: 64 SLGITMIELAT-GKFPYTQ 81 >SB_30649| Best HMM Match : zf-C2H2 (HMM E-Value=1.7e-24) Length = 463 Score = 45.6 bits (103), Expect = 2e-05 Identities = 25/74 (33%), Positives = 43/74 (58%), Gaps = 4/74 (5%) Query: 66 KSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLP--KPMRASVRLYELMVECW 123 K++V+ F LL+EI T G +P++ + ++ G G+ + ++ + L+ ECW Sbjct: 80 KTNVYVFGTLLYEIMT-GRWPFSHFPVESI-IWMVGKGKKQCLRHVKCPEKTKNLIRECW 137 Query: 124 SDDPHDRPTFAQIV 137 SD+ DRP FA+IV Sbjct: 138 SDNSEDRPDFAKIV 151 >SB_45| Best HMM Match : Pkinase (HMM E-Value=0) Length = 851 Score = 45.2 bits (102), Expect = 3e-05 Identities = 40/142 (28%), Positives = 69/142 (48%), Gaps = 17/142 (11%) Query: 13 DLAARNILV---DSTGVLKVADFGLSRSGVYVHTRSKPVPLR-----WLAPEAI-VHSQY 63 DL N+L D T LK+ADFGLS+ S + W+APE S++ Sbjct: 591 DLKPNNLLYHFQDETPRLKIADFGLSKDTTSASQSSTVIGTNVGCKVWMAPEVSRAPSKH 650 Query: 64 CSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFL----TGGGRLP--KPMRASV--RL 115 KSDV++ ++L I + G P+A+ S Q A + T + K + +S+ Sbjct: 651 SQKSDVFSCGLVLHYIMSKGKHPFAKESQTQENARIWEISTASSIVNDIKSLHSSLGPEA 710 Query: 116 YELMVECWSDDPHDRPTFAQIV 137 +++++ + DP DRP+ + ++ Sbjct: 711 KDIVIQALARDPEDRPSASNMI 732 >SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) Length = 751 Score = 44.8 bits (101), Expect = 4e-05 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Query: 62 QYCSKSDVW-AFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKP 108 QY S VW +F V+L+EI T+GG PY ++ +P +L G R+ P Sbjct: 697 QYLSSQKVWWSFGVVLYEICTIGGEPYPGIAGKDIPEYLEAGYRMSCP 744 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 44.8 bits (101), Expect = 4e-05 Identities = 29/77 (37%), Positives = 42/77 (54%), Gaps = 12/77 (15%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKP-----VPLRWL-APEAIVHS-QYCS 65 D+ N+L ++K+ADFGL+R TRS+P V RW APE ++ S Y S Sbjct: 91 DMKPENLLCTGHELVKIADFGLAR-----ETRSRPPYTDYVSTRWYRAPEVLLRSTNYSS 145 Query: 66 KSDVWAFAVLLWEIATL 82 D+WA ++ E+ TL Sbjct: 146 PIDIWAVGCIMAELYTL 162 >SB_14773| Best HMM Match : Pkinase (HMM E-Value=1.1e-05) Length = 194 Score = 44.0 bits (99), Expect = 8e-05 Identities = 28/71 (39%), Positives = 38/71 (53%), Gaps = 4/71 (5%) Query: 13 DLAARNILVDSTGVLKVADFGLSR--SGVYVHTRSKPVPLRWL-APEAIVHS-QYCSKSD 68 DL N+L+ STG LK+ADFGL+R S S V RW APE + + +Y D Sbjct: 1 DLKPANLLISSTGHLKIADFGLARVFSNEGERQYSHQVATRWYRAPELLYGARKYDEGVD 60 Query: 69 VWAFAVLLWEI 79 +WA + E+ Sbjct: 61 LWAVGCIFGEL 71 >SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) Length = 380 Score = 44.0 bits (99), Expect = 8e-05 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 5/77 (6%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKP--VPLRWLAPEAIVHSQ-YCSKSDV 69 DL N+L+ GVLK+ADFGL+R+ Y + P V L + +PE ++ ++ + + D+ Sbjct: 160 DLKVSNLLLTGKGVLKIADFGLARTFGYPYKPMTPVVVTLWYRSPELLLGAKVHTTAVDM 219 Query: 70 WAFAVLLWEIATLGGFP 86 WA + E+ LG P Sbjct: 220 WAVGCIFGEL--LGNKP 234 >SB_54329| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.16) Length = 313 Score = 43.6 bits (98), Expect = 1e-04 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 4/72 (5%) Query: 68 DVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGR---LPKPMRASVRLYELMVECWS 124 D ++F + ++E+ L P+ +L+ QV + G R PK +A+V +LM CW Sbjct: 75 DSFSFGMYIYELIALHQ-PFCDLNPAQVKQMIVDGLRPPLTPKDRKAAVFAMDLMAWCWE 133 Query: 125 DDPHDRPTFAQI 136 D RPT AQ+ Sbjct: 134 QDSEKRPTSAQV 145 >SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 43.2 bits (97), Expect = 1e-04 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 7/77 (9%) Query: 13 DLAARNILVDSTGVLKVADFGLS-RSGVYVHTRSKPVPL-RWLAPEAIVHSQYCS----- 65 DL A N+L+ S G +K+ADFG+S ++ + RS + W+APE +V Y Sbjct: 354 DLKAGNLLLASDGNVKMADFGVSAKNKKTLQKRSTFIGTPYWMAPEVVVTETYKDDPYDY 413 Query: 66 KSDVWAFAVLLWEIATL 82 K+D+W+ + L E+A + Sbjct: 414 KADIWSAGITLIELAQM 430 >SB_26833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 854 Score = 42.7 bits (96), Expect = 2e-04 Identities = 32/123 (26%), Positives = 53/123 (43%), Gaps = 4/123 (3%) Query: 30 ADFGLSRSGVYVHTRSKPV--PLRWLAPEAIVHSQYCSKSDVWAFAVLLWEIATLGGFPY 87 ADFGL++ ++ V + + PE + Y K+DVWA +L+++ATL P+ Sbjct: 376 ADFGLAKQKNPDASKMTSVVGTILYSCPEVVQSQPYGEKADVWAAGCILYQMATLQP-PF 434 Query: 88 AELSNYQVPAFLTGGGRLPKPMRA-SVRLYELMVECWSDDPHDRPTFAQIVDKLVIQQQL 146 + + + P P S ++ E + C P DRP Q+ + Sbjct: 435 YSSNMLALATKIVEASYAPIPSGLYSDKVAETVHRCLQAKPEDRPDIVQVAGGISEIMLT 494 Query: 147 YVD 149 YVD Sbjct: 495 YVD 497 >SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2229 Score = 42.7 bits (96), Expect = 2e-04 Identities = 49/182 (26%), Positives = 74/182 (40%), Gaps = 27/182 (14%) Query: 13 DLAARNILVDSTG-----VLKVADFGLSRSGVYVHTRSKPVPLRWLAPEA--IVHSQYCS 65 DL NILV S +K+ DFG + S APE + +Y Sbjct: 1639 DLKPENILVWSLNEGDDLYVKLIDFGTANFATSAGLISMKGTSGNHAPEMLDVEKREYTE 1698 Query: 66 KSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLY------ELM 119 + D++++A+LL++I T P+ EL G PK V Y ELM Sbjct: 1699 QVDIYSYAILLYQIITRK-LPFTELKREPEINQAVVNGERPKWRDCPVAFYGLPSLTELM 1757 Query: 120 VECWSDDPHDR------------PTFAQIVDKLVIQQQLYVDLECVLPPSEEDIGFKDYD 167 +ECW P R P F ++ K+ + + V CV+P ++E I +D Sbjct: 1758 LECWVSKPTRRPKSGDITQQVKMPAFQLVLGKMHVPSEQSVRHACVVPNAKE-IWIACFD 1816 Query: 168 YT 169 +T Sbjct: 1817 HT 1818 >SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) Length = 286 Score = 42.3 bits (95), Expect = 2e-04 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 4/70 (5%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVY---VHTRSKPVPLRWLAPEAIVHSQYCSKSDV 69 DL N+L+DS G +K+ D+G+ + G+ V + P ++APE + Y D Sbjct: 149 DLKLDNVLLDSDGHIKLTDYGMCKEGIRPGDVTSTFCGTP-NYIAPEILRGEDYGFSVDW 207 Query: 70 WAFAVLLWEI 79 WA VLL+E+ Sbjct: 208 WALGVLLYEM 217 >SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 42.3 bits (95), Expect = 2e-04 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 3/74 (4%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDVWAF 72 DL NIL+D G +K+ DFG ++ V+ T + +LAPE I + D WA Sbjct: 164 DLKPENILLDRDGHVKLTDFGFAKE-VHDKTWTLCGTPEYLAPEIIQSKGHNKAVDWWAL 222 Query: 73 AVLLWEIATLGGFP 86 +L++E+ L G+P Sbjct: 223 GILIYEM--LVGYP 234 >SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) Length = 490 Score = 42.3 bits (95), Expect = 2e-04 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 3/77 (3%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPV--PLRWLAPEAIVHSQYCSKSDVW 70 D+ + +IL+ S G +K++DFG R K + W+APE I Y ++ D+W Sbjct: 337 DIKSDSILLTSNGTVKLSDFGFCAQVTEDMPRRKSLVGTPYWMAPEVISRKPYGTEVDIW 396 Query: 71 AFAVLLWEIATLGGFPY 87 + +++ E+ G PY Sbjct: 397 SLGIMVLEMVD-GEPPY 412 >SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) Length = 870 Score = 41.9 bits (94), Expect = 3e-04 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 4/73 (5%) Query: 13 DLAARNILVDSTGVLKVADFGLSR--SGVYVHTRSKPVPLRWL-APEAIV-HSQYCSKSD 68 D+ NILV +G++K+ DFG +R + + V RW APE +V ++Y D Sbjct: 70 DVKPENILVSRSGIVKLCDFGFARTLASGQGEAYTDYVATRWYRAPELLVGDTKYGRAVD 129 Query: 69 VWAFAVLLWEIAT 81 VWA LL E+ T Sbjct: 130 VWAVGCLLAEMLT 142 >SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 41.9 bits (94), Expect = 3e-04 Identities = 21/69 (30%), Positives = 36/69 (52%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDVWAF 72 DL NI + V+K+ DFG+S+ + +++PE +Y KSD+WA Sbjct: 152 DLKTANIFLTKDTVVKLGDFGISKQLEGSKANTVLGTPYYISPEMCQGKEYNHKSDIWAL 211 Query: 73 AVLLWEIAT 81 +L+E+A+ Sbjct: 212 GCILYEMAS 220 >SB_53036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 41.5 bits (93), Expect = 4e-04 Identities = 36/147 (24%), Positives = 63/147 (42%), Gaps = 11/147 (7%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLR------WLAPEAIVHSQYCSK 66 DL N+LV + K+ADFG ++ H + P + APE + +K Sbjct: 160 DLKPGNVLVGANDHCKLADFGCCQAIEENHKPASPTKSNLTGTYAYRAPELLRGETPSTK 219 Query: 67 SDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTG---GGRLPKPMRASVRLYELMV-EC 122 +D++++ + LW++ T PY + + V + R+ + M Y +V +C Sbjct: 220 ADIYSYGICLWQMLTRER-PYGNENQHVVIFGVVAYQLRPRIARDMSDDDGQYVCLVQQC 278 Query: 123 WSDDPHDRPTFAQIVDKLVIQQQLYVD 149 W D RP I+ +L Q V+ Sbjct: 279 WEADHRLRPATGDILIRLYQSQGFQVE 305 >SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1378 Score = 41.5 bits (93), Expect = 4e-04 Identities = 32/133 (24%), Positives = 58/133 (43%), Gaps = 5/133 (3%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGV-YVHTRSKPVPLR-WLAPEAIVHSQYCSKSDVW 70 D+ + NIL+ G +K+ DFG + + RS V W+APE + QY + DVW Sbjct: 341 DIKSDNILLGMDGQVKLTDFGFCATITPEQNKRSTMVGTPYWMAPEVVTRKQYGPRVDVW 400 Query: 71 AFAVLLWEIATLGGFPYAELSNYQVPAFLTGGG--RLPKPMRASVRLYELMVECWSDDPH 128 + ++ E+ G PY + + + G L P + S + + + D Sbjct: 401 SLGIMAIEMVE-GEPPYLNENPLRALYLIATNGTPELAHPEKLSPVFKDFLAQSLEMDVE 459 Query: 129 DRPTFAQIVDKLV 141 R + +++ L+ Sbjct: 460 KRSSARELLQVLL 472 >SB_8000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 41.5 bits (93), Expect = 4e-04 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 6/83 (7%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGV---YVHTRSKPVPLRWLAPEAIVHSQYCSKSDV 69 DL N+L+D+ G +K+ADFG+ + + T P ++APE + Y D Sbjct: 443 DLKLDNVLLDADGHIKLADFGMCKENMAPGKTTTTFCGTP-DYIAPEILQEQPYGFSVDW 501 Query: 70 WAFAVLLWEIATLGGFPYAELSN 92 WA VL++E+ + G P E N Sbjct: 502 WALGVLMYEM--MAGQPPFEAEN 522 >SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) Length = 1602 Score = 41.1 bits (92), Expect = 5e-04 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 13/110 (11%) Query: 1 MGALGTGPVCPYDLAARNILVDSTGVLKVADFGLS------RSGVYVHTRSKPVPLRWLA 54 +G G + DL +RNILV G +AD GL+ + + + ++ R++A Sbjct: 330 IGTQGKPAIAHRDLKSRNILVKDNGTCCIADLGLAVCHNSEQDTLDIPYGNRVGTRRYMA 389 Query: 55 PEAIVHS----QYCS--KSDVWAFAVLLWEIATLGGFPYAELSNYQVPAF 98 PE + S +C+ D++AF ++LWEI T + +YQ+P F Sbjct: 390 PEFLEDSNQVRNFCAYKHGDIYAFGLVLWEI-TRRCICSDKCEDYQLPYF 438 >SB_49051| Best HMM Match : Pkinase_Tyr (HMM E-Value=7.5e-11) Length = 310 Score = 41.1 bits (92), Expect = 5e-04 Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 11/87 (12%) Query: 14 LAARNILVDS--TGVLKVADFGLSRSGVYVHTRSKPVPLRWLAPEAIVHS--QYCSKS-D 68 L + +I+VD T + +AD+ S +++ P W+APE + S + +S D Sbjct: 197 LKSTHIMVDDDLTARISMADYRFS----FMNLSKMETP-NWMAPEVLQKSPPEVDQRSAD 251 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQV 95 +W++A+LLWE+ T P+AELS ++ Sbjct: 252 MWSYAILLWELVT-REVPFAELSPMEI 277 >SB_40460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 41.1 bits (92), Expect = 5e-04 Identities = 16/33 (48%), Positives = 21/33 (63%) Query: 104 RLPKPMRASVRLYELMVECWSDDPHDRPTFAQI 136 +L +P LYELM+ CW +P DRP FA+I Sbjct: 196 KLEQPKACPSELYELMLHCWVHEPQDRPGFAEI 228 >SB_41623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1604 Score = 40.7 bits (91), Expect = 7e-04 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 6/76 (7%) Query: 115 LYELMVECWSDDPHDRPTFAQIVDKL--VIQQQLYVDLECVLPPSEEDIGFKDYDYTLP- 171 LY+LM+ CW DP RPTF Q+++ + +++ + E L + + +Y LP Sbjct: 1383 LYDLMLRCWQHDPAQRPTFTQLLETIDKILEGKTTETGEEYLDLENDTTEEQSPEYLLPE 1442 Query: 172 ---SPLPGDTQLMYKD 184 +PLP +T + K+ Sbjct: 1443 DLNTPLPPETPMEDKN 1458 >SB_56201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 40.3 bits (90), Expect = 0.001 Identities = 26/97 (26%), Positives = 47/97 (48%), Gaps = 6/97 (6%) Query: 70 WAFAVLLWEIATLGGFPYAELSN---YQVPAFLTGGGRLPKPMRASVRLYELMVECWSDD 126 ++F ++LWE+ + P+ +++ +++ + G R P + EL+ CW D Sbjct: 96 FSFGIILWEMISRRK-PFDDMAGSPPFRIMWAVHIGRRPPLIKNIPKPIEELITSCWDKD 154 Query: 127 PHDRPTFAQIVDKLVIQQQLY--VDLECVLPPSEEDI 161 P RP+F++IV L Q + D V PP D+ Sbjct: 155 PDKRPSFSRIVIFLNHLMQFFPGADTCLVFPPGSPDL 191 >SB_18129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/66 (31%), Positives = 38/66 (57%), Gaps = 2/66 (3%) Query: 79 IATLGG-FPYAELSNYQ-VPAFLTGGGRLPKPMRASVRLYELMVECWSDDPHDRPTFAQI 136 + TL G PYA + Q + + + G RL +P ++Y LM++ W +P +RP+F I Sbjct: 172 LRTLAGTVPYAAMETGQDILSEVKRGYRLEQPPECDDKIYALMLDTWDPNPLNRPSFEVI 231 Query: 137 VDKLVI 142 V+++ + Sbjct: 232 VNRVEV 237 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 4/36 (11%) Query: 13 DLAARNILVDSTGVLKVADFGLSR----SGVYVHTR 44 DLAARN+L+ + V+DFGLSR SG+Y R Sbjct: 72 DLAARNVLLGRSLEPIVSDFGLSRDIYESGMYEDLR 107 >SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) Length = 632 Score = 39.9 bits (89), Expect = 0.001 Identities = 20/70 (28%), Positives = 39/70 (55%), Gaps = 5/70 (7%) Query: 13 DLAARNILVDSTGVLKVADFGLS---RSGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDV 69 DL N+L+D G ++++D GL+ R+G + R + + ++APE + + +Y D Sbjct: 210 DLKPENLLLDDYGHVRISDLGLAVQIRNGETI--RGRVGTIGYMAPEVVKNERYTFSPDW 267 Query: 70 WAFAVLLWEI 79 W L++E+ Sbjct: 268 WGLGCLIYEM 277 >SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 39.9 bits (89), Expect = 0.001 Identities = 41/146 (28%), Positives = 66/146 (45%), Gaps = 15/146 (10%) Query: 8 PVCPYDLAARNILV---DSTGVLKVADFGLSRSGVYVHTRSKPVP--LRWLAPEAIVHSQ 62 P DL +NIL+ DS K+ D GL++ ++T PVP +++APE V + Sbjct: 132 PTIHRDLCPKNILILKKDSVITAKITDVGLAKMAK-MNTFQSPVPGTQKYMAPETFVFAA 190 Query: 63 -----YCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRA---SVR 114 Y + D+++F + + E LG P + + L + A S Sbjct: 191 TNSAIYGPEIDIFSFGMTMLE-TILGRLPSFMENPLAGEGEFSTHSMLKDDIYAIGESNP 249 Query: 115 LYELMVECWSDDPHDRPTFAQIVDKL 140 L L+++C DP RPT A++V L Sbjct: 250 LKALVLQCLETDPTLRPTAAELVSAL 275 >SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 920 Score = 39.5 bits (88), Expect = 0.002 Identities = 36/128 (28%), Positives = 55/128 (42%), Gaps = 8/128 (6%) Query: 13 DLAARNILVDSTGVLKVADFGLS---RSGVYVHTRSKPVPLRWLAPEAIVHSQYCS-KSD 68 DL A N+L+D +K+ADFG + G ++T P + APE Y + D Sbjct: 279 DLKAENLLLDQNMNIKIADFGFGNYYKPGNPLNTWCGSPP--YAAPEVFEGKIYDGPQLD 336 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPH 128 +W+ V+L+ + G P+ + S Q G+ P S L+ DP+ Sbjct: 337 IWSLGVVLY-VLVCGALPF-DGSTLQALRDRVLEGKFRIPFFMSTECEHLIRHMLVKDPN 394 Query: 129 DRPTFAQI 136 R T QI Sbjct: 395 QRYTIEQI 402 >SB_41930| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.4e-10) Length = 597 Score = 39.5 bits (88), Expect = 0.002 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 6/75 (8%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLR----WLAPEAI--VHSQYCSK 66 +L + N LVD V K+AD+GL R + + + + + W+APE + S Sbjct: 348 NLTSSNCLVDRMWVCKIADYGLQRFSKHTYEPEEQLTGQTAKLWMAPEHMRNASSTGSQP 407 Query: 67 SDVWAFAVLLWEIAT 81 DV++F V+L EI T Sbjct: 408 GDVYSFGVILSEIVT 422 Score = 28.3 bits (60), Expect = 4.0 Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 121 ECWSDDPHDRPTFAQI 136 +CWS++P RPTF I Sbjct: 547 QCWSEEPSARPTFRDI 562 >SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 39.5 bits (88), Expect = 0.002 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 3/127 (2%) Query: 13 DLAARNILVDSTGVLKVADFGLS-RSGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDVWA 71 DL N+ ++ +KV DFGL+ R+ ++ ++APE + + + DVW+ Sbjct: 163 DLKLGNLFLNDDMEVKVGDFGLATRAEEGERKKTLCGTPNYIAPEVLSKRGHSFEVDVWS 222 Query: 72 FAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPHDRP 131 +L+ + L G P E + + P + S L+++ DP RP Sbjct: 223 VGCILYTL--LVGKPPFETQSLKTTYDRIKRNEYYIPSKVSHTAQLLIIKLLRPDPTTRP 280 Query: 132 TFAQIVD 138 T Q++D Sbjct: 281 TMQQVLD 287 >SB_26242| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.8e-15) Length = 1019 Score = 39.1 bits (87), Expect = 0.002 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 2/80 (2%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKP--VPLRWLAPEAIVHSQYCSKSDVW 70 +L A N LV G +K++ F +RS + V + P + + + S+SD+W Sbjct: 387 ELVAENCLVGDNGRVKISGFHCARSSWCCDPLNDDDYVTRVAITPPEVKYQEPSSQSDIW 446 Query: 71 AFAVLLWEIATLGGFPYAEL 90 A+ +L++ I T G P +L Sbjct: 447 AYGLLVYTIITAGQKPTRDL 466 >SB_47182| Best HMM Match : Pkinase (HMM E-Value=1e-09) Length = 198 Score = 39.1 bits (87), Expect = 0.002 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 17/106 (16%) Query: 10 CPYDLAARNILVDSTGVLKVADFGLSRS------------GVYVHTRSKPVPLR----WL 53 C D+ A NIL++S G K+ADFG++ V T +K + W+ Sbjct: 74 CDRDIKAGNILLNSEGHAKLADFGVAGQLTFCLADSIGEITVLQDTMAKRNTVIGTPFWM 133 Query: 54 APEAIVHSQYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFL 99 APE I Y +D+W+ + E+A G PYA++ +V L Sbjct: 134 APEVIQEVGYDCLADIWSLGITAMEMAE-GKPPYADIHPMRVRCLL 178 >SB_41406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/35 (45%), Positives = 22/35 (62%) Query: 102 GGRLPKPMRASVRLYELMVECWSDDPHDRPTFAQI 136 G R+P+P S LY ++ ECW DP RPTF+ + Sbjct: 13 GYRMPRPDYCSEELYAVIWECWQLDPTVRPTFSML 47 >SB_25618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 671 Score = 38.7 bits (86), Expect = 0.003 Identities = 13/31 (41%), Positives = 21/31 (67%) Query: 115 LYELMVECWSDDPHDRPTFAQIVDKLVIQQQ 145 +Y +M+ CW +DP +RPTF ++ D + QQ Sbjct: 415 VYSVMLRCWQEDPDERPTFDELRDNMQALQQ 445 Score = 33.1 bits (72), Expect = 0.14 Identities = 10/31 (32%), Positives = 22/31 (70%) Query: 48 VPLRWLAPEAIVHSQYCSKSDVWAFAVLLWE 78 +P++W+ PE++++ Q S SDV++ + W+ Sbjct: 394 LPVKWMPPESLLYGQSSSASDVYSVMLRCWQ 424 >SB_7625| Best HMM Match : Pkinase (HMM E-Value=6.8e-10) Length = 279 Score = 38.3 bits (85), Expect = 0.004 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 11/89 (12%) Query: 3 ALGTGPVCPYDLAARNILVDSTGV--LKVADFGLS---RSGVYVHTRSKPVPLRWLAPEA 57 AL + DL NIL+ G +KV DFG S +Y + +S+ + APE Sbjct: 11 ALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSR----FYRAPEV 66 Query: 58 IVHSQYCSKSDVWAFAVLLWEIATLGGFP 86 I+ ++Y D+W+F +L E+ T G+P Sbjct: 67 ILGARYGMPIDMWSFGCILAELLT--GYP 93 >SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) Length = 967 Score = 37.9 bits (84), Expect = 0.005 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 7/76 (9%) Query: 13 DLAARNILVDSTGV-LKVADFGLSR------SGVYVHTRSKPVPLRWLAPEAIVHSQYCS 65 D+ NILVDSTG +++ADFG + +G + ++APE + Y Sbjct: 740 DIKGANILVDSTGQDIRIADFGAAARLATQITGAGEFQGQLLGTIAFMAPEVLRGESYGR 799 Query: 66 KSDVWAFAVLLWEIAT 81 DVW+ +L E+AT Sbjct: 800 SCDVWSVGCVLIEMAT 815 >SB_37367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/40 (40%), Positives = 23/40 (57%) Query: 116 YELMVECWSDDPHDRPTFAQIVDKLVIQQQLYVDLECVLP 155 Y LM ECW+ +P +RP F+ IV +L + E +LP Sbjct: 2 YALMYECWNPEPKNRPAFSDIVSRLEETLRAKAGYEEILP 41 >SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) Length = 937 Score = 37.9 bits (84), Expect = 0.005 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 7/79 (8%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS---GVYVHTRSKPVPLRWLAPEAIVHSQYCS-KSD 68 DL A N+L+D+ +K+ADFG S G + T P + APE +Y + D Sbjct: 205 DLKAENLLLDADMNIKIADFGFSNEFTPGNKLDTFCGSPP--YAAPELFQGKKYDGPEVD 262 Query: 69 VWAFAVLLWEIATLGGFPY 87 VW+ V+L+ + + G P+ Sbjct: 263 VWSLGVILYTLVS-GSLPF 280 >SB_8354| Best HMM Match : Pkinase (HMM E-Value=6.3e-15) Length = 280 Score = 37.9 bits (84), Expect = 0.005 Identities = 28/84 (33%), Positives = 47/84 (55%), Gaps = 6/84 (7%) Query: 13 DLAARNILVDSTGVLKVADFGLSR--SGVYVHT--RSKPVPLRWL-APEAIVHSQYCSKS 67 DL N+L+++T LK+ DFGL+R + HT ++ V RW APE +++S+ SK+ Sbjct: 38 DLKPSNLLLNTTCDLKICDFGLARIADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYSKA 97 Query: 68 -DVWAFAVLLWEIATLGGFPYAEL 90 D+W+ L + P+ +L Sbjct: 98 IDIWSARSYLQSLPYKPKTPFIKL 121 >SB_30278| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 37.5 bits (83), Expect = 0.007 Identities = 14/39 (35%), Positives = 21/39 (53%) Query: 102 GGRLPKPMRASVRLYELMVECWSDDPHDRPTFAQIVDKL 140 G L KP +Y++M CW+ DP RP F I+ ++ Sbjct: 1 GVHLGKPEDCPDHIYDVMKSCWNKDPSQRPNFQMIISQI 39 >SB_10421| Best HMM Match : Guanylate_cyc (HMM E-Value=0) Length = 1485 Score = 37.5 bits (83), Expect = 0.007 Identities = 41/166 (24%), Positives = 74/166 (44%), Gaps = 28/166 (16%) Query: 1 MGALGTGPVCPY-DLAARNILVDSTGVLKVADFGL-----SRSGVYVHTRSKPVPLRWLA 54 M A+ P+ + +L + N L+DS K+ D+GL +++ + + L W A Sbjct: 636 MEAIHNSPIQAHGNLKSSNCLIDSRWACKITDYGLDLLRANQTPKDIGEFAVYKNLFWTA 695 Query: 55 PEAIV-------HSQYCSKSDVWAFAVLLWEIATLGGFPYAE----LSNYQV-------- 95 PE + DV+++ ++L+EI T PY+ LS+ V Sbjct: 696 PELLPLADGFKDRKNKTQAGDVYSYGIVLYEIITRDE-PYSTNTDTLSSKDVIELVRKRQ 754 Query: 96 -PAFLTGGGRLPKPMRASVRLYELMVECWSDDPHDRPTFAQIVDKL 140 PAF + + ++ ++ ++ +CW +D RPTF+ I KL Sbjct: 755 EPAFRPQFSKFMEE-KSGHKMVQVTQDCWDNDAQKRPTFSAIKKKL 799 >SB_6315| Best HMM Match : GBP_PSP (HMM E-Value=5.2) Length = 119 Score = 37.5 bits (83), Expect = 0.007 Identities = 14/39 (35%), Positives = 21/39 (53%) Query: 102 GGRLPKPMRASVRLYELMVECWSDDPHDRPTFAQIVDKL 140 G L KP +Y++M CW+ DP RP F I+ ++ Sbjct: 1 GVHLGKPEDCPDHIYDVMKSCWNKDPSQRPNFQMIISQI 39 >SB_59282| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.6e-10) Length = 199 Score = 37.1 bits (82), Expect = 0.009 Identities = 38/131 (29%), Positives = 63/131 (48%), Gaps = 23/131 (17%) Query: 14 LAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDVWAFA 73 L ++N++VDS + K+AD+GL G +++ L + +S D +A+ Sbjct: 75 LKSKNVVVDSYWICKIADYGL---GSIRQSQND------LGQDGKAYS------DCYAYG 119 Query: 74 VLLWEIATLGGFPYAELSN------YQVPAFLTGGGRLPKPMRASVRLY-ELMVECWSDD 126 ++L EIA L P++ L Y V +T R P ++ Y ELM CW + Sbjct: 120 IILQEIA-LREAPFSTLLLSPKEVVYHVRKGMTPYCRPQVPPDSAPSAYRELMAICWDEV 178 Query: 127 PHDRPTFAQIV 137 P RPTF+ ++ Sbjct: 179 PERRPTFSGVL 189 >SB_1646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 36.7 bits (81), Expect = 0.011 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Query: 19 ILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDVWAF 72 I V S+ +L SR + V ++ K +P++W+APE+I ++ S SD W F Sbjct: 66 ISVSSSQILGCRVGSRSRRIIKVASKGK-LPIKWMAPESINFRRFTSASDAWMF 118 >SB_51866| Best HMM Match : Pkinase (HMM E-Value=0) Length = 948 Score = 36.3 bits (80), Expect = 0.015 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 9/88 (10%) Query: 13 DLAARNILVDSTGVLKVADFGLSR---SGVYVHTR--SKPVPLRWL-APEAIVH-SQYCS 65 DL N+LV+ LK+ DFG++R S R ++ V RW APE ++ ++Y Sbjct: 150 DLKPSNLLVNENAELKIGDFGMARGLCSSPLEQKRFMTEYVATRWYRAPELMLSLNEYSE 209 Query: 66 KSDVWAFAVLLWEIATLGGFPYAELSNY 93 D+W+ +L E+ +G P +NY Sbjct: 210 AIDMWSVGCILAEM--IGRRPLFPGANY 235 >SB_29500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 36.3 bits (80), Expect = 0.015 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 6/111 (5%) Query: 25 GVLKVADFGLSRSGVYVHTRSKPV-PLRWLAPEAIVHSQYCSKSDVWAFAVLLWEIATLG 83 G K+ DFGLS+ R+ L+++APE + Y + D W+ ++++ + G Sbjct: 94 GHAKIIDFGLSKLVTPGERRTTICGTLQYMAPEVLKGECYTAACDWWSLGIVMFTLLA-G 152 Query: 84 GFPYA--ELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPHDRPT 132 +PYA E N Q G +P + S R +L+ + DP R T Sbjct: 153 KYPYACQEDHNAQRHVVEETGYEVPSHVCESAR--DLLSQLLQKDPKLRLT 201 >SB_22843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1138 Score = 36.3 bits (80), Expect = 0.015 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Query: 44 RSKPVPLRWLAPEAIVHSQYCSKSDVWAFAVLLWEIATLGGFPY 87 R K P ++APE ++ S + +SD+WAF LL+E+ T G P+ Sbjct: 176 RPKTSPY-YMAPEVLMGSPHSMQSDLWAFGCLLFELFT-GDLPF 217 >SB_18146| Best HMM Match : Pkinase (HMM E-Value=0) Length = 888 Score = 36.3 bits (80), Expect = 0.015 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Query: 44 RSKPVPLRWLAPEAIVHSQYCSKSDVWAFAVLLWEIATLGGFPY 87 R K P ++APE ++ S + +SD+WAF LL+E+ T G P+ Sbjct: 176 RPKTSPY-YMAPEVLMGSPHSMQSDLWAFGCLLFELFT-GDLPF 217 >SB_28889| Best HMM Match : ANF_receptor (HMM E-Value=1.1e-34) Length = 933 Score = 35.9 bits (79), Expect = 0.020 Identities = 13/24 (54%), Positives = 18/24 (75%) Query: 117 ELMVECWSDDPHDRPTFAQIVDKL 140 +LM +CW+DDP RPTF+ I +L Sbjct: 663 KLMTQCWNDDPQARPTFSDIKRQL 686 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/23 (56%), Positives = 16/23 (69%) Query: 13 DLAARNILVDSTGVLKVADFGLS 35 DL + L+DS V KVADFGL+ Sbjct: 557 DLRSSKCLIDSRWVCKVADFGLT 579 >SB_25669| Best HMM Match : LRR_1 (HMM E-Value=9.1e-33) Length = 1065 Score = 35.9 bits (79), Expect = 0.020 Identities = 20/35 (57%), Positives = 23/35 (65%), Gaps = 4/35 (11%) Query: 13 DLAARNILVDSTGVLKVADFGLSR----SGVYVHT 43 DLAARN+L+ T KVADFGL+R G YV T Sbjct: 934 DLAARNVLMTDTLTAKVADFGLARDIYCEGKYVKT 968 >SB_18109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 59 Score = 35.9 bits (79), Expect = 0.020 Identities = 13/24 (54%), Positives = 18/24 (75%) Query: 117 ELMVECWSDDPHDRPTFAQIVDKL 140 +LM +CW+DDP RPTF+ I +L Sbjct: 29 KLMTQCWNDDPQARPTFSDIKRQL 52 >SB_24824| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.32) Length = 193 Score = 35.5 bits (78), Expect = 0.026 Identities = 23/44 (52%), Positives = 28/44 (63%), Gaps = 5/44 (11%) Query: 13 DLAARNILVDSTGVLKVADFGLSR----SGVYVHTRSKP-VPLR 51 DLAARN+LV V KVADFGL+R G+Y+ + P PLR Sbjct: 5 DLAARNVLVGLGLVAKVADFGLARHVTTDGLYIVSALGPNSPLR 48 >SB_36802| Best HMM Match : Pkinase (HMM E-Value=2.2e-23) Length = 318 Score = 35.1 bits (77), Expect = 0.035 Identities = 29/106 (27%), Positives = 51/106 (48%), Gaps = 17/106 (16%) Query: 52 WLAPEAIVHSQY-CSKSDVWAFAVLLWE--------IATLG--GFPYAELSNYQVPAFLT 100 W + EA+ C K+D++A+ +++WE ++ LG G ++S + T Sbjct: 202 WKSKEALNRGGVVCDKTDIFAYGLVIWEMLALDVPHVSLLGTDGSMDTDMSCEEDSEEYT 261 Query: 101 G--GGRLPKPMRASVRLYELMVE----CWSDDPHDRPTFAQIVDKL 140 G R P P + + ++E C ++DP DRP+ Q+VD L Sbjct: 262 AALGTRPPLPKENYDQSFNPLIELFDWCTAEDPRDRPSARQVVDFL 307 >SB_55593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 35.1 bits (77), Expect = 0.035 Identities = 10/26 (38%), Positives = 19/26 (73%) Query: 62 QYCSKSDVWAFAVLLWEIATLGGFPY 87 ++ +KSDVW++ + +WE+ + G PY Sbjct: 1 KFSTKSDVWSYGIFMWELFSFGRVPY 26 >SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) Length = 187 Score = 35.1 bits (77), Expect = 0.035 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 17/83 (20%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSG-------VYVHTRSKPVPL----------RWLAP 55 D+ N+L+ S G +K+ DFGLS+ G +Y H+ + +LAP Sbjct: 82 DIKPDNLLITSLGHIKLTDFGLSKIGLMNSTTRMYEHSLDRDTKQFMDKQVFGTPDYLAP 141 Query: 56 EAIVHSQYCSKSDVWAFAVLLWE 78 E I+ Y D W+ ++L+E Sbjct: 142 EVILRQGYGRAVDWWSMGIILYE 164 >SB_9361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 35.1 bits (77), Expect = 0.035 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 7/54 (12%) Query: 116 YELMVECWSDDPHDRPTFAQIVDKLVIQQQLYVDLECVLPPSEEDIGFKDYDYT 169 Y +M CW+ P DRPTF ++ ++L +QL +D E L D+ F+D +Y+ Sbjct: 2 YAMMRSCWASSPEDRPTFTKLRNQL---EQL-MDREDEL---YIDVNFEDAEYS 48 >SB_34104| Best HMM Match : SH2 (HMM E-Value=1.6e-24) Length = 421 Score = 34.7 bits (76), Expect = 0.046 Identities = 14/25 (56%), Positives = 21/25 (84%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS 37 DLAARN+LV + +K++DFG+SR+ Sbjct: 304 DLAARNVLVVNDSFVKISDFGMSRA 328 Score = 31.1 bits (67), Expect = 0.57 Identities = 13/37 (35%), Positives = 19/37 (51%) Query: 87 YAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECW 123 Y LS + + G RLP P + +Y+LM +CW Sbjct: 336 YKSLSGQAILEKIESGYRLPAPAKLPSCVYQLMKDCW 372 >SB_18517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 34.7 bits (76), Expect = 0.046 Identities = 44/155 (28%), Positives = 65/155 (41%), Gaps = 30/155 (19%) Query: 13 DLAARNILVDSTGVLKVADFGLSR-SGVYVHTRSKPVP----------------LRWLAP 55 DL NI+V+S V K+ADFG + + Y + +P + AP Sbjct: 195 DLKPSNIIVNSHDVCKLADFGCCQVTDPYELSADSLLPPSPTHSPSARSFLTGTFAYRAP 254 Query: 56 EAIVHSQYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASV-- 113 E + K+D+++ + LW++ T PY L + V F +L +P ASV Sbjct: 255 ELLKGEPATVKADIYSLGICLWQMLTREQ-PYG-LESQFVVIFGVVANQL-RPSLASVSC 311 Query: 114 -------RLY-ELMVECWSDDPHDRPTFAQIVDKL 140 LY EL+ W DP RP Q+ KL Sbjct: 312 DRQEGKHELYIELITALWLADPVKRPNANQVTKKL 346 >SB_18360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.3 bits (75), Expect = 0.061 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Query: 52 WLAPEAIVHSQYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPK 107 W+APE I + + KSD+W+ ++E+AT G P++ + + G +P+ Sbjct: 7 WMAPEVIRETGHGRKSDIWSIGCTVFEMAT-GQPPWSNVPPLSAIFAIGNGSPVPR 61 >SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 727 Score = 34.3 bits (75), Expect = 0.061 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 7/83 (8%) Query: 13 DLAARNILVDSTG---VLKVADFGLSRSGVYVHTRSKPVPLR---WLAPEAIVHSQYCSK 66 DL N+L G + + DFGLS + R+ ++APE ++ Y + Sbjct: 190 DLKPENLLYYHPGNDSKIMITDFGLSNLRKHPDDRTMETTCGTPGYMAPEVLLSKPYTNS 249 Query: 67 SDVWAFAVLLWEIATLGGFPYAE 89 D+W+ V+ + + + G P+A+ Sbjct: 250 VDIWSIGVITFNVLS-GQMPFAD 271 >SB_45888| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.4e-25) Length = 561 Score = 34.3 bits (75), Expect = 0.061 Identities = 17/24 (70%), Positives = 19/24 (79%) Query: 13 DLAARNILVDSTGVLKVADFGLSR 36 DLAARN+LV V KVADFGL+R Sbjct: 526 DLAARNVLVGLGLVAKVADFGLAR 549 >SB_44566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 34.3 bits (75), Expect = 0.061 Identities = 19/86 (22%), Positives = 44/86 (51%), Gaps = 6/86 (6%) Query: 14 LAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPV----PL-RWLAPEAIVHSQYCSKSD 68 L + ++++ + K+ +F +++ + +P+ PL W+APE + D Sbjct: 106 LGSHSVVISESYNAKICNFNYAQAVKESDSSGEPISHCEPLYEWMAPEQLRGKPADKLGD 165 Query: 69 VWAFAVLLWEIATLGGFPYAELSNYQ 94 V++F V++WE T P+ ++N++ Sbjct: 166 VYSFGVMVWECVTRKR-PFDNIANFK 190 >SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) Length = 310 Score = 33.5 bits (73), Expect = 0.11 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 18/104 (17%) Query: 1 MGALGTGPVCPYDLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKP----VPLRW---L 53 MG L + DL ++N+ ++ + DFGL ++P VP W L Sbjct: 124 MGYLHARGIVHTDLRSKNVFLELNSKAVITDFGLYSVAGLTARSARPGYLMVPYGWLYYL 183 Query: 54 APEAI----------VHSQYCSKSDVWAFAVLLWEIATLGGFPY 87 APE I Q+ +K+DV++F + +E+ GG+P+ Sbjct: 184 APEVIRTLTPFQDAPESKQFTTKTDVYSFGTVWYEMIA-GGWPW 226 >SB_7330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 33.5 bits (73), Expect = 0.11 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 7/49 (14%) Query: 119 MVECWSDDPHDRPTFAQIVDKLVIQQQ---LYVDL----ECVLPPSEED 160 M+ CWS +P DRP+F ++ D L Q+ YV++ + VLPP ED Sbjct: 1 MLACWSCEPADRPSFKELRDILWDMQKEESPYVNVDPSQDFVLPPVTED 49 >SB_58458| Best HMM Match : Guanylate_cyc (HMM E-Value=1.2e-36) Length = 1065 Score = 33.1 bits (72), Expect = 0.14 Identities = 35/145 (24%), Positives = 59/145 (40%), Gaps = 22/145 (15%) Query: 14 LAARNILVDSTGVLKVADFGLS--RSGVYVHTRSKPVPL----RWLAPE----AIVHSQY 63 L + N +VD VLK+ D+GL+ +S + + W APE A + Sbjct: 534 LKSPNCVVDGRWVLKITDYGLNKFKSNQDISEEEGEYAMYYRKLWTAPELLRAADPRPRG 593 Query: 64 CSKSDVWAFAVLLWEIATLGG-FPYAELSN-----------YQVPAFLTGGGRLPKPMRA 111 K DV++F +++ E+ T G F + +N + P F + Sbjct: 594 TQKGDVYSFGIIVQELLTRSGPFDLSYYTNEPSDIIEKVTRVESPPFRPKLSTIVLEGPT 653 Query: 112 SVRLYELMVECWSDDPHDRPTFAQI 136 + +L CW ++P RP F +I Sbjct: 654 VAGIVDLAKWCWEENPDHRPDFEEI 678 >SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) Length = 759 Score = 33.1 bits (72), Expect = 0.14 Identities = 27/78 (34%), Positives = 37/78 (47%), Gaps = 7/78 (8%) Query: 13 DLAARNILV----DSTGVLKVADFGLSRSGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSD 68 DL N+LV D LK+ADFGL+ P ++APE + + Y K D Sbjct: 568 DLKPENLLVHKRSDGQTHLKLADFGLAMEVTAPIFTVCGTPT-YVAPEILEENGYGLKVD 626 Query: 69 VWAFAVLLWEIATLGGFP 86 +WA V+ + L GFP Sbjct: 627 MWAAGVITY--IMLCGFP 642 >SB_22670| Best HMM Match : Pkinase (HMM E-Value=0) Length = 662 Score = 33.1 bits (72), Expect = 0.14 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 13/93 (13%) Query: 1 MGALGTGPVCPYDLAARNILVDSTGVLKVADFGLS------RSGVYVHTRSKPV-PLRWL 53 +G G + D+ ++NILV +ADFGL+ G+ ++ + V R++ Sbjct: 487 LGTQGKPMIAHRDIKSKNILVKENLTCCIADFGLAVKYIPETKGIDLNKDTNRVGTKRYM 546 Query: 54 APEAIVHS------QYCSKSDVWAFAVLLWEIA 80 +PE + + +D+++FA++LWEI+ Sbjct: 547 SPEVLSQTIDPESFSAYKMADMYSFALVLWEIS 579 >SB_55533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.1 bits (72), Expect = 0.14 Identities = 12/42 (28%), Positives = 24/42 (57%) Query: 86 PYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDP 127 PY+ + ++ + L G RL +P +Y++M+ CW+ +P Sbjct: 2 PYSAVVPNELLSMLMSGFRLSRPPLCPEEIYDVMMSCWNAEP 43 >SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) Length = 558 Score = 33.1 bits (72), Expect = 0.14 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 8/75 (10%) Query: 13 DLAARNILVDSTGVLKVADFGLS-RSGVYVHTRSK-PVPL-RWLAPEAIVH-----SQYC 64 D+ N+L+D TG +K+ADFG S R SK PV ++APE + Y Sbjct: 205 DVKPDNVLIDRTGHIKLADFGSSARLSADKKVFSKMPVGTPEYIAPEVLTSMDGSGGAYG 264 Query: 65 SKSDVWAFAVLLWEI 79 + D W+ V+ +E+ Sbjct: 265 VECDWWSLGVVAYEM 279 >SB_26437| Best HMM Match : Pkinase (HMM E-Value=3.6e-36) Length = 436 Score = 33.1 bits (72), Expect = 0.14 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 14/86 (16%) Query: 8 PVCPYDLAARNILVDSTGVL----KVADFGLSR-----SGVYVHTRSKPVPLRW-LAPEA 57 PV YDL NIL+ TG K+ DFGLS+ + S+ W L PE Sbjct: 270 PVIHYDLKPGNILLVGTGAFSGETKITDFGLSKIFESDEDDSMELTSQGAGTYWYLPPEC 329 Query: 58 IV----HSQYCSKSDVWAFAVLLWEI 79 V + SK DVW+ V+ +++ Sbjct: 330 FVVGKEPPKISSKVDVWSVGVIFYQM 355 >SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) Length = 560 Score = 33.1 bits (72), Expect = 0.14 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Query: 13 DLAARNILVDSTGVLKVADFGLS--RSGVYVHTRS 45 DL N+L+DS G++K+ADFG S HTR+ Sbjct: 463 DLKGGNVLMDSKGIVKLADFGASVHLDDTTTHTRN 497 >SB_22496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLRWLAPEAIV 59 DL N+L+D G LKV DFG ++ V T + +LAPE I+ Sbjct: 28 DLKPENLLIDEKGYLKVTDFGFAKR-VKGRTWTLCGTPEYLAPEIIL 73 >SB_7684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 32.7 bits (71), Expect = 0.19 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 1/96 (1%) Query: 56 EAIVHSQYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRL 115 E + Y KSD+W+ L++E+ L P+ + ++ A + G P P S L Sbjct: 1 EQVNKRSYNEKSDIWSLGCLMYELCALSP-PFTAMDQIRLEAKIKVGRFHPIPSHYSSSL 59 Query: 116 YELMVECWSDDPHDRPTFAQIVDKLVIQQQLYVDLE 151 +L+ + H I++ + +Q +DLE Sbjct: 60 SQLINSMLQVNLHMAVESMFILNAVGMQVTKKIDLE 95 >SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 32.7 bits (71), Expect = 0.19 Identities = 13/27 (48%), Positives = 19/27 (70%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGV 39 DL N+L+D G +K+ADFG+ + GV Sbjct: 411 DLKLDNVLLDKDGHIKLADFGMCKEGV 437 >SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) Length = 501 Score = 32.7 bits (71), Expect = 0.19 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 6/59 (10%) Query: 28 KVADFGLS--RSGVYVHTRSKPV---PLRWLAPEAIVHSQYCSKSDVWAFAVLLWEIAT 81 K+ DFGLS + GV + + V P+ ++APE I Y + DVW+ V+++ + T Sbjct: 124 KITDFGLSIVKGGVGSDSMMQSVCGTPM-YMAPEVIDDLGYSQQCDVWSIGVIMYTLFT 181 >SB_42333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 32.3 bits (70), Expect = 0.25 Identities = 13/23 (56%), Positives = 17/23 (73%) Query: 13 DLAARNILVDSTGVLKVADFGLS 35 DLAARN+LV + K+ DFGL+ Sbjct: 5 DLAARNVLVGTNNTCKITDFGLA 27 >SB_43658| Best HMM Match : Pkinase (HMM E-Value=1.49939e-42) Length = 457 Score = 31.9 bits (69), Expect = 0.33 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 15/91 (16%) Query: 5 GTGPVCPY-DLAARNILVDSTGVLKVADFGLS------RSGVYVHTRSKPV--PLRWLAP 55 G+ P + D+ ++NILV S V D GL+ + V + K R++AP Sbjct: 317 GSKPAIAHRDIKSKNILVKSNYTCAVGDLGLAVMYSQDKDSVDMGENPKIAVGTRRYMAP 376 Query: 56 EAIVHS--QYC----SKSDVWAFAVLLWEIA 80 E + + C ++DV+AF ++LWEIA Sbjct: 377 EILEETINAKCINSFKRADVYAFGLVLWEIA 407 >SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 31.9 bits (69), Expect = 0.33 Identities = 27/104 (25%), Positives = 51/104 (49%), Gaps = 10/104 (9%) Query: 13 DLAARNILVDSTG---VLKVADFGLSRS----GVYVHTRSKPVPLRWLAPEAIVHSQYCS 65 D+ N+L+ G +K+ADFGL+++ + + P+ +LAPE ++ Sbjct: 151 DIKPDNLLLKRIGNNVTIKLADFGLAQALPNDTDVISCGASGAPM-FLAPETVLEEPIGR 209 Query: 66 KSDVWAFAVLLWEIATLGGFPYAELSNYQ-VPAFLTGGGRLPKP 108 D+WA V+ + + +G P+ S+ Q + + L G +P P Sbjct: 210 AVDIWACGVIFY-LLLVGYPPFWSNSDEQLLLSILRGQYTMPSP 252 >SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) Length = 428 Score = 31.9 bits (69), Expect = 0.33 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 5/55 (9%) Query: 13 DLAARNILVDSTGVLKVADFGLSR---SGVYVHTRSKPVPLRWLAPEAIVHSQYC 64 DL N+L+DS +K+ADFGLS G ++ T S P + APE I ++ C Sbjct: 155 DLKPENLLLDSQLNIKIADFGLSNIMTDGEFLQT-SCGSP-NYAAPEVISGNKNC 207 >SB_10837| Best HMM Match : Pkinase (HMM E-Value=1.49939e-42) Length = 386 Score = 31.9 bits (69), Expect = 0.33 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 15/91 (16%) Query: 5 GTGPVCPY-DLAARNILVDSTGVLKVADFGLS------RSGVYVHTRSKPV--PLRWLAP 55 G+ P + D+ ++NILV S V D GL+ + V + K R++AP Sbjct: 246 GSKPAIAHRDIKSKNILVKSNYTCAVGDLGLAVMYSQDKDSVDMGENPKIAVGTRRYMAP 305 Query: 56 EAIVHS--QYC----SKSDVWAFAVLLWEIA 80 E + + C ++DV+AF ++LWEIA Sbjct: 306 EILEETINAKCINSFKRADVYAFGLVLWEIA 336 >SB_18047| Best HMM Match : Pkinase (HMM E-Value=2.1e-07) Length = 179 Score = 31.5 bits (68), Expect = 0.43 Identities = 24/93 (25%), Positives = 48/93 (51%), Gaps = 9/93 (9%) Query: 13 DLAARNILVDSTGVLKVADFGLS----RSGVYVHTRSKPVPLRWLAPEAIVHS-QYCSKS 67 D+ ++NILV S ++DFGL+ +S T + R++APE + + + +S Sbjct: 52 DVKSKNILVKSDLTCCISDFGLALKFDQSDKLGETHGQVGTKRYMAPEVLEGAISFTRES 111 Query: 68 ----DVWAFAVLLWEIATLGGFPYAELSNYQVP 96 D++A ++LWE+ + + +Y++P Sbjct: 112 FLRIDMYACGLVLWELLSRFSVHDDPVEDYRLP 144 >SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1219 Score = 31.5 bits (68), Expect = 0.43 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 3/74 (4%) Query: 67 SDVWAFAVLLWEIATLGGFPYAELSNYQVPAF-LTGGGRLPK-PMRASVRLYELMVECWS 124 SDVW+ V+L+ + T G FP+ + Q+ L G PK R S +L EL+ + Sbjct: 301 SDVWSLGVVLFAMVT-GRFPFDDQDRRQLLRHTLAGKFSYPKGSARLSDQLKELVKNMLT 359 Query: 125 DDPHDRPTFAQIVD 138 D R T ++ D Sbjct: 360 ADIKSRLTLEEVYD 373 >SB_11487| Best HMM Match : Guanylate_cyc (HMM E-Value=2.3e-06) Length = 360 Score = 31.5 bits (68), Expect = 0.43 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 115 LYELMVECWSDDPHDRPTFAQIVD 138 L L+ +CW++DP +RP F +IV+ Sbjct: 226 LLMLIRDCWAEDPEERPHFFRIVE 249 >SB_1987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 31.5 bits (68), Expect = 0.43 Identities = 21/82 (25%), Positives = 39/82 (47%), Gaps = 6/82 (7%) Query: 52 WLAPEAIVHSQYCSKSDVWAFAVLLWEIATLGGFPYAE---LSNYQVPAFLTGGGRLPKP 108 ++APE I++ + SD W+ +L++E+ T G P++ + Y + L G + P Sbjct: 120 YVAPEIILNKGHDLSSDYWSLGILIFELLT-GSPPFSSSDPMKTYNI--ILRGLDMVEFP 176 Query: 109 MRASVRLYELMVECWSDDPHDR 130 R L+ D+P +R Sbjct: 177 KRIGRNPQNLIKRLCKDNPVER 198 >SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) Length = 1023 Score = 31.1 bits (67), Expect = 0.57 Identities = 28/127 (22%), Positives = 50/127 (39%), Gaps = 6/127 (4%) Query: 13 DLAARNILVDSTGVLKVADFGLS---RSGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDV 69 D+ N ++S L++ DFGL+ + Y P ++APE + + + D Sbjct: 556 DIKVGNFFINSNMELRLGDFGLAVRLKPDEYKIRTMCGTP-NYIAPEVLSKEGHSYEVDT 614 Query: 70 WAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWSDDPHD 129 WA +++ + L G P E + + P R S L+ +P + Sbjct: 615 WALGCVMYTM--LVGHPPFETKSLRETYRRIRNNDYTIPSRVSDSAARLIQRMLHANPEN 672 Query: 130 RPTFAQI 136 RP + I Sbjct: 673 RPKLSDI 679 >SB_52266| Best HMM Match : DUF1665 (HMM E-Value=1.3) Length = 697 Score = 31.1 bits (67), Expect = 0.57 Identities = 14/45 (31%), Positives = 25/45 (55%) Query: 102 GGRLPKPMRASVRLYELMVECWSDDPHDRPTFAQIVDKLVIQQQL 146 G P P+R S + L+ + +PHDRP+ ++ K IQ+++ Sbjct: 48 GSYPPIPLRYSADIRMLVAQLLKRNPHDRPSVNTVLKKNFIQKRI 92 >SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) Length = 323 Score = 31.1 bits (67), Expect = 0.57 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 8/82 (9%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPV------PLRWLAPEAIVHSQY-CS 65 DL N+L+D + ++DFG +R + T K + + APE + Y + Sbjct: 175 DLKCENLLLDKDLNIIISDFGFARDCLTTATGKKKLSHTYCGSYAYAAPEILKGIAYDAT 234 Query: 66 KSDVWAFAVLLWEIATLGGFPY 87 +DVW+ V+L+ + G P+ Sbjct: 235 LADVWSMGVILYTM-LCGRLPF 255 >SB_55159| Best HMM Match : Ribosomal_S17e (HMM E-Value=2.8) Length = 250 Score = 30.7 bits (66), Expect = 0.75 Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Query: 55 PEAIVHSQYCSKSDVWAFAVLLWEIATLGGFP 86 PE + +QY +SD+W+F + L E+A +G +P Sbjct: 162 PERLQGNQYTIQSDIWSFGLSLVEMA-IGRYP 192 >SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 622 Score = 30.7 bits (66), Expect = 0.75 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 6/80 (7%) Query: 13 DLAARNILV---DSTGVLKVADFGLSRS--GVYVHTRSKPVPLRWLAPEAIVHSQYCSKS 67 DL N+L+ +++ +KVADFG++ T + +++PE + Y Sbjct: 48 DLKPHNVLLANRENSAPIKVADFGVAVELPPEGCITSGRLGTPHFMSPEVVNRQPYGKPV 107 Query: 68 DVWAFAVLLWEIATLGGFPY 87 DVW ++L+ I G +P+ Sbjct: 108 DVWGCGIILF-ILLSGNYPF 126 >SB_41151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 30.7 bits (66), Expect = 0.75 Identities = 9/25 (36%), Positives = 16/25 (64%) Query: 116 YELMVECWSDDPHDRPTFAQIVDKL 140 YE+M +CW + P RP F ++ ++ Sbjct: 42 YEVMTDCWQEKPDLRPNFTELRQRI 66 >SB_34306| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 30.3 bits (65), Expect = 0.99 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 6/85 (7%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSK-PVPL---RWLAPEAIVHSQYCSKSD 68 D+ NIL S G + DFG+++ H ++ + + + +PE ++SD Sbjct: 131 DIKPANILFRSDGTAVITDFGVAKEVELDHDLTQFGIAVGSPSYSSPEQAQCQALDARSD 190 Query: 69 VWAFAVLLWEIATLGGFPYAELSNY 93 +++ V+L E+ T G PY +NY Sbjct: 191 IYSLGVILLEMLT-GSNPY-RATNY 213 >SB_1344| Best HMM Match : HGTP_anticodon (HMM E-Value=4.4) Length = 168 Score = 30.3 bits (65), Expect = 0.99 Identities = 18/81 (22%), Positives = 41/81 (50%), Gaps = 1/81 (1%) Query: 62 QYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVE 121 +Y KSD+WA +L+E+ TL + + ++ + + G R + + L+ + Sbjct: 33 RYNQKSDMWAVGCVLYEVLTLKRV-FDASNPLRLVSDIVKGHYEEIDERYTEEMNSLVNK 91 Query: 122 CWSDDPHDRPTFAQIVDKLVI 142 S +P DRP+ ++++ ++ Sbjct: 92 LLSQNPDDRPSVQELLEMPIL 112 >SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) Length = 322 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 5/48 (10%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVHTRSKPVPLRWLAPEAIVH 60 D+ N+L++ G +K+ADFG S VH S PL P VH Sbjct: 152 DIKPENLLLNYKGDIKIADFGWS-----VHAPSSRYPLLQGPPNVDVH 194 >SB_41218| Best HMM Match : zf-C2H2 (HMM E-Value=0.68) Length = 807 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/38 (31%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Query: 116 YELMVECWSDDPHDRPTFAQI---VDKLVIQQQLYVDL 150 Y +M++CW RPTF +I ++K++ ++ Y+ L Sbjct: 77 YAVMLDCWQLSAQRRPTFVEISRLLNKMLSDEREYISL 114 >SB_4396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 556 Score = 29.5 bits (63), Expect = 1.7 Identities = 35/137 (25%), Positives = 66/137 (48%), Gaps = 20/137 (14%) Query: 8 PVCPYDLAARNILVDSTGVL---KVADFGLSRSGVYVHTRSKPVPLRWLAPEAIVHSQYC 64 P+ D+++ N+L+ + KV+D+G + + T S P + + PEA S+ Sbjct: 429 PIIHRDISSANVLLWRHMDVWRGKVSDYGTANFVHHSMTVS-PGAVVYSPPEAHT-SRQS 486 Query: 65 SKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLY-ELMVECW 123 K DV+++ VLL E+ + FP + + QV + + LY +++ C Sbjct: 487 PKLDVYSYGVLLCEM-NIREFPDPDRRDEQV-------------VMVTSHLYRDVIRRCL 532 Query: 124 SDDPHDRPTFAQIVDKL 140 +D +RP A+++D L Sbjct: 533 QEDSENRPFMAEVIDVL 549 >SB_58457| Best HMM Match : Guanylate_cyc (HMM E-Value=0) Length = 410 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Query: 115 LYELMVECWSDDPHDRPTFAQI 136 L ELM +CW ++P RP F +I Sbjct: 28 LRELMKQCWDENPDMRPDFNEI 49 >SB_54823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/23 (56%), Positives = 17/23 (73%) Query: 13 DLAARNILVDSTGVLKVADFGLS 35 +L + N LVDS VLK+ D+GLS Sbjct: 60 NLKSSNCLVDSRWVLKITDYGLS 82 >SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) Length = 476 Score = 29.5 bits (63), Expect = 1.7 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 7/79 (8%) Query: 13 DLAARNILVDST---GVLKVADFGLSRS--GVYVHTRSKPVPLRWLAPEAIVHSQYCSKS 67 DL N+L+ S ++K+ADFGL+ G + +L+PE + Y Sbjct: 139 DLKPENLLLASRERGAMVKLADFGLAIEVDGERLGWYGFAGTPGYLSPEVLKKDPYGKPV 198 Query: 68 DVWAFAVLLWEIATLGGFP 86 D+WA V+L+ + L G+P Sbjct: 199 DLWACGVILYIL--LVGYP 215 >SB_4000| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.2e-09) Length = 177 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/24 (45%), Positives = 19/24 (79%) Query: 13 DLAARNILVDSTGVLKVADFGLSR 36 DLAARNI + ++G K+++ G+S+ Sbjct: 121 DLAARNIFLGNSGTAKISNIGISQ 144 >SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) Length = 235 Score = 29.1 bits (62), Expect = 2.3 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 10/80 (12%) Query: 13 DLAARNILV---DSTGVLKVADFGLSR---SGVYVHTRSKPVPLRWLAPEAIVHSQYCSK 66 DL N+L D + ++DFGLS+ G ++ T P ++APE + Y Sbjct: 134 DLKPENLLYYSPDEDSKIMISDFGLSKIEAQGSFMDTACG-TP-GYVAPEVLKQQPYGKA 191 Query: 67 SDVWAFAVLLWEIATLGGFP 86 D W+ V+ + + L G+P Sbjct: 192 VDCWSIGVITYIL--LCGYP 209 >SB_42528| Best HMM Match : Pkinase (HMM E-Value=1.3e-13) Length = 255 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/24 (50%), Positives = 18/24 (75%) Query: 13 DLAARNILVDSTGVLKVADFGLSR 36 D+ NILV++ G +K+ DFG+SR Sbjct: 118 DVKPSNILVNTRGQVKLCDFGVSR 141 >SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20) Length = 956 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Query: 59 VHSQYCSKSDVWAFAVLLWEIATLGGFPYAELSNYQV 95 VH Y K+D+W+F + E+AT G PYA+ +V Sbjct: 848 VHG-YNHKADIWSFGITAIELAT-GTAPYAKFPAMKV 882 >SB_1188| Best HMM Match : Guanylate_cyc (HMM E-Value=6.7) Length = 215 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Query: 111 ASVRLYELMVECWSDDPHDRPTFAQIVDKL 140 +++ LM ECW + P RP F I+ +L Sbjct: 26 SNIAYIHLMQECWEESPALRPNFFSILRRL 55 >SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1184 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 13 DLAARNILVDSTGVLKVADFGLSRSGVYVH 42 D+ NIL+D G +K+ DFGL + H Sbjct: 779 DIKPDNILIDKDGHIKLTDFGLCTGFRWTH 808 >SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 819 Score = 28.3 bits (60), Expect = 4.0 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 27 LKVADFGLSRSGVYVHTRSKPVPL-RWLAPEAIVHSQYCSKSDVWAFAVLLW 77 +K+ DFG +R R V +LAPE +++ Y D+W+ V+++ Sbjct: 632 VKLCDFGFARIIEEKSFRRSVVGTPAYLAPEVLLNQPYNRSLDMWSVGVVIY 683 >SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) Length = 434 Score = 28.3 bits (60), Expect = 4.0 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Query: 17 RNILVDSTGVLKVA---DFGLSRSGVYVH-TRSKPVPLRWLAPEAIVHSQYCSKSDVWAF 72 R+ILVD V DFGLS+ + T S + ++APE + + +D W++ Sbjct: 80 RDILVDVQHPFIVRLNYDFGLSKESEHDQKTYSFCGTVEYMAPEVVNRRGHSQAADWWSY 139 Query: 73 AVLL 76 VL+ Sbjct: 140 GVLM 143 >SB_50980| Best HMM Match : Guanylate_cyc (HMM E-Value=0) Length = 313 Score = 28.3 bits (60), Expect = 4.0 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Query: 13 DLAARNILVDSTGVLKVADFGLS----RSGVYVHTRSKPVPLRWLAPEAI 58 +L + N LVDS VLK+ D+GL ++ V S W+APE + Sbjct: 14 NLKSSNCLVDSRWVLKITDYGLPTFRIKARKTVENYSYYRDQLWVAPELL 63 >SB_2079| Best HMM Match : Pkinase (HMM E-Value=4.2e-10) Length = 210 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 13 DLAARNILVDSTGVLKVADFGLSR 36 D+ N+ + +TGV+K+ D GL R Sbjct: 138 DIKPANVFITATGVVKLGDLGLGR 161 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 13 DLAARNILVDSTGVLKVADFGLSR 36 D+ N+ + +TGV+K+ D GL R Sbjct: 174 DIKPANVFITATGVVKLGDLGLGR 197 >SB_54275| Best HMM Match : Galactosyl_T (HMM E-Value=2.4e-20) Length = 767 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 87 YAELSNYQVPAFLTGGGRLPKPMRAS-VRLYELMV 120 Y+ SN +PAF+ RLPK MR +R Y ++ Sbjct: 4 YSLRSNIYLPAFVASENRLPKMMRTRFMRQYSSLI 38 >SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) Length = 2160 Score = 27.9 bits (59), Expect = 5.3 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 5/72 (6%) Query: 65 SKSDVWAFAVLLWEIATLGGFPYAELSNYQVPAFLTGGGRLPKPMRASVRLYELMVECWS 124 +KSD+WA LL+++ P+ E A P+ R S L+ L+ Sbjct: 1297 TKSDIWALGCLLYKLCFF-TLPFGE----SPLAIQNAQFTFPENSRYSKGLHSLISYILD 1351 Query: 125 DDPHDRPTFAQI 136 DP RP Q+ Sbjct: 1352 PDPDTRPDIYQV 1363 >SB_34265| Best HMM Match : rve (HMM E-Value=0.0015) Length = 1069 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 168 YTLPSPLPGDTQLMYKD 184 Y LP PLPGD+ L KD Sbjct: 145 YELPPPLPGDSPLTQKD 161 >SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 27.9 bits (59), Expect = 5.3 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Query: 13 DLAARNILVD-STGVLKVADFGLSR--SGVYVHTRSKPVPLRWLAPEAIVHS-QYCSKSD 68 DL NIL+D S +K+ DFGLS SG + P + APE +Y + D Sbjct: 141 DLKMENILLDESKKTIKIVDFGLSNKYSGGELLKTQCGSP-EYAAPELFKKGCRYGGEVD 199 Query: 69 VWA 71 +W+ Sbjct: 200 IWS 202 >SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) Length = 256 Score = 27.9 bits (59), Expect = 5.3 Identities = 8/28 (28%), Positives = 16/28 (57%) Query: 52 WLAPEAIVHSQYCSKSDVWAFAVLLWEI 79 ++APE + Y D W+ V+++E+ Sbjct: 194 YIAPEVFIQQGYTKSCDFWSLGVIMYEM 221 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 27.9 bits (59), Expect = 5.3 Identities = 10/25 (40%), Positives = 16/25 (64%) Query: 13 DLAARNILVDSTGVLKVADFGLSRS 37 D+ N+L+ T +LK+ DFG+ S Sbjct: 150 DIKPENLLISKTDILKLCDFGIKIS 174 >SB_12086| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.2e-07) Length = 524 Score = 27.9 bits (59), Expect = 5.3 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 4/35 (11%) Query: 14 LAARNILVDSTGVLKVADFGL----SRSGVYVHTR 44 LAA N+LV + LK+ D GL SR GV++ R Sbjct: 483 LAAHNVLVAADECLKITDVGLRDLASRGGVFLPDR 517 >SB_1495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 461 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 87 YAELSNYQVPAFLTGGGRLPKPMRAS-VRLYELMV 120 Y+ SN +PAF+ RLPK MR +R Y ++ Sbjct: 4 YSLRSNIYLPAFVASENRLPKMMRTRFMRQYSSLI 38 >SB_54204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 27.5 bits (58), Expect = 7.0 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 7/65 (10%) Query: 26 VLKVADFG----LSRSGVYVHTRSKPVPLRWLAPEAIVHSQYCSKSDVWAFAVLLWEIAT 81 + K+ DFG L R + + K P+ +LAPE I+ D W+ VLL + Sbjct: 12 IAKIGDFGFAVKLPRDRDVICCQPKGAPM-YLAPETILEDPIGCPVDSWSCGVLLHTL-- 68 Query: 82 LGGFP 86 + G+P Sbjct: 69 IVGYP 73 >SB_54589| Best HMM Match : Extensin_2 (HMM E-Value=0.0081) Length = 667 Score = 27.1 bits (57), Expect = 9.3 Identities = 10/34 (29%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 54 APEAIVHSQYCSKSDVWAFAVLLWEIATLGGFPY 87 APE I+ Y +++D+W+ ++++ T G P+ Sbjct: 63 APEVIMSKAYDARADLWSLGTIVYQCLT-GKAPF 95 >SB_42409| Best HMM Match : Pkinase (HMM E-Value=6.7e-24) Length = 465 Score = 27.1 bits (57), Expect = 9.3 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Query: 25 GVLKVADFGLSRSGVYVHTRSKPV--PLRWLAPEAIVHSQYCSKSDVWAFAVLLWEI 79 G + + DFGL + G+ + +LAPE + Y D W +L+E+ Sbjct: 254 GHIVLTDFGLCKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEM 310 >SB_31810| Best HMM Match : Pkinase (HMM E-Value=0.17) Length = 152 Score = 27.1 bits (57), Expect = 9.3 Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 6/80 (7%) Query: 13 DLAARNILVDSTGVLKVADFG----LSRSGVYVHTRSKPV-PLRWLAPEAIVHSQYCSKS 67 DL NIL+D +K+ DFG L++ R+ V ++++PE + + C ++ Sbjct: 2 DLKPENILLDENMHIKITDFGTAKILNKDEEKNKGRNSFVGTAQYVSPELLTDKRACKRN 61 Query: 68 DVWAF-AVLLWEIATLGGFP 86 + F ++ + + GFP Sbjct: 62 EYQIFQKIIKNDYSFPSGFP 81 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.321 0.140 0.444 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,891,772 Number of Sequences: 59808 Number of extensions: 283754 Number of successful extensions: 833 Number of sequences better than 10.0: 189 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 40 Number of HSP's that attempted gapping in prelim test: 561 Number of HSP's gapped (non-prelim): 223 length of query: 184 length of database: 16,821,457 effective HSP length: 78 effective length of query: 106 effective length of database: 12,156,433 effective search space: 1288581898 effective search space used: 1288581898 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -