BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000831-TA|BGIBMGA000831-PA|undefined (55 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY129451-1|AAM76193.1| 787|Drosophila melanogaster RE01517p pro... 27 4.1 AE014298-1891|AAF48260.1| 787|Drosophila melanogaster CG10617-P... 27 4.1 >AY129451-1|AAM76193.1| 787|Drosophila melanogaster RE01517p protein. Length = 787 Score = 26.6 bits (56), Expect = 4.1 Identities = 16/45 (35%), Positives = 23/45 (51%) Query: 1 MFYTVKAAAIITLSAYSTVERIVSSHRSPAGLIDGGSAAVLLGLR 45 M ++V ++ T TV + +S +P G I GS AV GLR Sbjct: 689 MIFSVPPPSLTTTQLRVTVFGVTTSGVTPLGHIVAGSCAVGKGLR 733 >AE014298-1891|AAF48260.1| 787|Drosophila melanogaster CG10617-PA protein. Length = 787 Score = 26.6 bits (56), Expect = 4.1 Identities = 16/45 (35%), Positives = 23/45 (51%) Query: 1 MFYTVKAAAIITLSAYSTVERIVSSHRSPAGLIDGGSAAVLLGLR 45 M ++V ++ T TV + +S +P G I GS AV GLR Sbjct: 689 MIFSVPPPSLTTTQLRVTVFGVTTSGVTPLGHIVAGSCAVGKGLR 733 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.319 0.132 0.357 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,432,054 Number of Sequences: 52641 Number of extensions: 63146 Number of successful extensions: 116 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 114 Number of HSP's gapped (non-prelim): 2 length of query: 55 length of database: 24,830,863 effective HSP length: 36 effective length of query: 19 effective length of database: 22,935,787 effective search space: 435779953 effective search space used: 435779953 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -