BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000831-TA|BGIBMGA000831-PA|undefined (55 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g42560.1 68415.m05267 late embryogenesis abundant domain-cont... 27 2.0 >At2g42560.1 68415.m05267 late embryogenesis abundant domain-containing protein / LEA domain-containing protein low similarity to LEA protein [Glycine max] GI:1389897; contains Pfam profile PF02987: Late embryogenesis abundant protein Length = 635 Score = 26.6 bits (56), Expect = 2.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Query: 6 KAAAIITLSAYSTVERIVSSHRSPAGLIDG 35 KAAA+ +A+ T E++V ++ AG ++G Sbjct: 409 KAAAVGWTAAHFTTEKVVQGTKAVAGTVEG 438 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.319 0.132 0.357 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,119,729 Number of Sequences: 28952 Number of extensions: 28472 Number of successful extensions: 48 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 47 Number of HSP's gapped (non-prelim): 1 length of query: 55 length of database: 12,070,560 effective HSP length: 36 effective length of query: 19 effective length of database: 11,028,288 effective search space: 209537472 effective search space used: 209537472 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -