BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000831-TA|BGIBMGA000831-PA|undefined (55 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9XA51 Cluster: Putative molybdenum cofactor biosynthes... 31 4.6 UniRef50_A1A0G5 Cluster: Two component system response regulator... 30 8.0 >UniRef50_Q9XA51 Cluster: Putative molybdenum cofactor biosynthesis protein; n=2; Streptomyces|Rep: Putative molybdenum cofactor biosynthesis protein - Streptomyces coelicolor Length = 465 Score = 31.1 bits (67), Expect = 4.6 Identities = 13/32 (40%), Positives = 20/32 (62%) Query: 20 ERIVSSHRSPAGLIDGGSAAVLLGLRIRKETT 51 E +++ H +PA LIDG + + G RI +TT Sbjct: 137 EGVLAGHAAPAPLIDGEAVRIATGARIPPDTT 168 >UniRef50_A1A0G5 Cluster: Two component system response regulatory protein; n=1; Bifidobacterium adolescentis ATCC 15703|Rep: Two component system response regulatory protein - Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083) Length = 105 Score = 30.3 bits (65), Expect = 8.0 Identities = 15/38 (39%), Positives = 21/38 (55%) Query: 16 YSTVERIVSSHRSPAGLIDGGSAAVLLGLRIRKETTPR 53 Y TV R S R P+ + + S+AV+ GL I K P+ Sbjct: 4 YRTVRRSPWSERQPSAVSNAPSSAVMCGLNITKMRPPK 41 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.319 0.132 0.357 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 56,186,530 Number of Sequences: 1657284 Number of extensions: 1485125 Number of successful extensions: 3613 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3611 Number of HSP's gapped (non-prelim): 2 length of query: 55 length of database: 575,637,011 effective HSP length: 35 effective length of query: 20 effective length of database: 517,632,071 effective search space: 10352641420 effective search space used: 10352641420 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -