SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000831-TA|BGIBMGA000831-PA|undefined
         (55 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_32481| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   2.8  

>SB_32481| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 499

 Score = 26.6 bits (56), Expect = 2.8
 Identities = 19/53 (35%), Positives = 22/53 (41%)

Query: 1   MFYTVKAAAIITLSAYSTVERIVSSHRSPAGLIDGGSAAVLLGLRIRKETTPR 53
           M  T   A  + L   S    +V      A L  GGS A LL LR +K   PR
Sbjct: 367 MLLTSTIAICMLLPPGSNFMSLVGFFSFAAWLFYGGSFAALLWLRYKKPEMPR 419


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.319    0.132    0.357 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,587,278
Number of Sequences: 59808
Number of extensions: 38314
Number of successful extensions: 60
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 59
Number of HSP's gapped (non-prelim): 1
length of query: 55
length of database: 16,821,457
effective HSP length: 35
effective length of query: 20
effective length of database: 14,728,177
effective search space: 294563540
effective search space used: 294563540
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 52 (25.0 bits)

- SilkBase 1999-2023 -