GeneModel BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000831-TA|BGIBMGA000831-PA|undefined
         (55 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g42560.1 68415.m05267 late embryogenesis abundant domain-cont...    27   2.0  

>At2g42560.1 68415.m05267 late embryogenesis abundant
           domain-containing protein / LEA domain-containing
           protein low similarity to LEA protein [Glycine max]
           GI:1389897; contains Pfam profile PF02987: Late
           embryogenesis abundant protein
          Length = 635

 Score = 26.6 bits (56), Expect = 2.0
 Identities = 11/30 (36%), Positives = 20/30 (66%)

Query: 6   KAAAIITLSAYSTVERIVSSHRSPAGLIDG 35
           KAAA+   +A+ T E++V   ++ AG ++G
Sbjct: 409 KAAAVGWTAAHFTTEKVVQGTKAVAGTVEG 438


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.319    0.132    0.357 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,119,729
Number of Sequences: 28952
Number of extensions: 28472
Number of successful extensions: 48
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 47
Number of HSP's gapped (non-prelim): 1
length of query: 55
length of database: 12,070,560
effective HSP length: 36
effective length of query: 19
effective length of database: 11,028,288
effective search space: 209537472
effective search space used: 209537472
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 51 (24.6 bits)