SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000830-TA|BGIBMGA000830-PA|undefined
         (140 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_05_1340 + 35797923-35799881                                         27   5.6  

>02_05_1340 + 35797923-35799881
          Length = 652

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 20  TKKYLDSEVKSGFLVLLGPGGMRQDVRVIVYRTSLEHFAVI 60
           TKK  ++EV+ G+  +L PGG+R  +   V    L+ F+ I
Sbjct: 401 TKKEAEAEVEGGWREVLEPGGVRHALVCGVAIQILQQFSGI 441


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.321    0.135    0.398 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,014,162
Number of Sequences: 37544
Number of extensions: 147335
Number of successful extensions: 210
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 209
Number of HSP's gapped (non-prelim): 1
length of query: 140
length of database: 14,793,348
effective HSP length: 75
effective length of query: 65
effective length of database: 11,977,548
effective search space: 778540620
effective search space used: 778540620
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 55 (26.2 bits)

- SilkBase 1999-2023 -