BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000830-TA|BGIBMGA000830-PA|undefined
(140 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
02_05_1340 + 35797923-35799881 27 5.6
>02_05_1340 + 35797923-35799881
Length = 652
Score = 27.1 bits (57), Expect = 5.6
Identities = 15/41 (36%), Positives = 24/41 (58%)
Query: 20 TKKYLDSEVKSGFLVLLGPGGMRQDVRVIVYRTSLEHFAVI 60
TKK ++EV+ G+ +L PGG+R + V L+ F+ I
Sbjct: 401 TKKEAEAEVEGGWREVLEPGGVRHALVCGVAIQILQQFSGI 441
Database: rice
Posted date: Oct 3, 2007 3:31 PM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.321 0.135 0.398
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,014,162
Number of Sequences: 37544
Number of extensions: 147335
Number of successful extensions: 210
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 209
Number of HSP's gapped (non-prelim): 1
length of query: 140
length of database: 14,793,348
effective HSP length: 75
effective length of query: 65
effective length of database: 11,977,548
effective search space: 778540620
effective search space used: 778540620
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 55 (26.2 bits)
- SilkBase 1999-2023 -