BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000829-TA|BGIBMGA000829-PA|IPR004871|CPSF A subunit, C-terminal, IPR011046|WD40-like, IPR003006|Immunoglobulin/major histocompatibility complex (1218 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 25 9.1 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 25 9.1 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 25.4 bits (53), Expect = 9.1 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query: 350 ACEFGNHYLYQIAHLGDEDDEPEFSSAMPLEEGD 383 A +F N Y+ ++ H +ED+E + +A P E+ D Sbjct: 874 AKQFANDYINEVLHEDNEDEERQ--AAGPSEDWD 905 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 25.4 bits (53), Expect = 9.1 Identities = 15/67 (22%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 802 EMKKHRRIQMAQEMREXXXXXXPEEQQLANEMADAFLSDTLPEYIFSSPKAGAGMWASLI 861 ++++ R+ Q Q+ ++ +QQ + PE I SP G W SL+ Sbjct: 455 QLRQQRQQQQPQQQQQQRPQQQRPQQQRPQQQRSQQRKPAKPELIEVSPNEGQD-WESLL 513 Query: 862 RVVDMGI 868 +V + Sbjct: 514 LLVQTAV 520 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,288,802 Number of Sequences: 2123 Number of extensions: 55830 Number of successful extensions: 204 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 204 Number of HSP's gapped (non-prelim): 2 length of query: 1218 length of database: 516,269 effective HSP length: 72 effective length of query: 1146 effective length of database: 363,413 effective search space: 416471298 effective search space used: 416471298 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -