Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000828-TA|BGIBMGA000828-PA|IPR008994|Nucleic
acid-binding, OB-fold, IPR001208|MCM, IPR008049|MCM protein 6
         (799 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain tran...    23   8.2  

>AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain
           transcription factor Prothoraxlessprotein.
          Length = 323

 Score = 23.0 bits (47), Expect = 8.2
 Identities = 16/66 (24%), Positives = 27/66 (40%), Gaps = 2/66 (3%)

Query: 615 MHCSGHVTPAHVHEAYRLLNKSIIRVEQPDIHLDEDEPQCEPSMDVDQDEPNGTAETPSN 674
           M   G V+  H H+       + ++V Q    +  D   C+PS+ + Q  P      P +
Sbjct: 13  MRNGGVVSAEHPHQHQHY--GAAVQVPQGGGAVQPDPGSCDPSVGLRQGIPPHHYGGPPS 70

Query: 675 GDSAPK 680
           G   P+
Sbjct: 71  GGQPPQ 76


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.318    0.134    0.380 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 160,947
Number of Sequences: 317
Number of extensions: 6310
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 1
length of query: 799
length of database: 114,650
effective HSP length: 62
effective length of query: 737
effective length of database: 94,996
effective search space: 70012052
effective search space used: 70012052
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 47 (23.0 bits)