BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000828-TA|BGIBMGA000828-PA|IPR008994|Nucleic acid-binding, OB-fold, IPR001208|MCM, IPR008049|MCM protein 6 (799 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 26 1.4 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 7.4 AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 23 7.4 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 25.8 bits (54), Expect = 1.4 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Query: 14 KDEVGIRCQKLFQDFLEEFKEDNEIKYEKHAKELLKP-ELSTLEVSFD 60 K EV C K F D L + E ++I + HAK + E +T + S D Sbjct: 526 KIEVTEDCNKSFNDLLTQVAELDQIYADTHAKLVQAAFEQNTTDQSMD 573 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 7.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Query: 286 QAVSRRFGTAELPTHDLTTEDMRKQMTDKE 315 Q V+R +G +TTE+MRK + E Sbjct: 1892 QLVNRNYGVNARGKDGMTTEEMRKLIERNE 1921 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 23.4 bits (48), Expect = 7.4 Identities = 7/20 (35%), Positives = 12/20 (60%) Query: 529 AIARKIVDLHCNKEESYDCV 548 ++ R + D H ++E Y CV Sbjct: 20 SLKRHVADKHAERQEEYRCV 39 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.134 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,129 Number of Sequences: 429 Number of extensions: 8003 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 3 length of query: 799 length of database: 140,377 effective HSP length: 63 effective length of query: 736 effective length of database: 113,350 effective search space: 83425600 effective search space used: 83425600 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -