BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000827-TA|BGIBMGA000827-PA|IPR007835|MOFRL (421 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g08670.1 68416.m01007 expressed protein 34 0.20 At1g48660.1 68414.m05446 auxin-responsive GH3 family protein sim... 33 0.47 At3g48820.2 68416.m05332 glycosyl transferase family 29 protein ... 32 0.63 At3g48820.1 68416.m05331 glycosyl transferase family 29 protein ... 32 0.63 At3g23670.1 68416.m02976 phragmoplast-associated kinesin-related... 32 0.63 At4g28080.1 68417.m04027 expressed protein 32 0.83 At1g48670.1 68414.m05447 auxin-responsive GH3 family protein sim... 32 0.83 At4g09650.1 68417.m01585 ATP synthase delta chain, chloroplast, ... 31 1.1 At5g06970.1 68418.m00789 expressed protein 30 2.5 At1g17360.1 68414.m02116 COP1-interacting protein-related simila... 30 2.5 At1g78920.1 68414.m09201 vacuolar-type H+-translocating inorgani... 30 3.3 At1g16780.1 68414.m02016 vacuolar-type H+-translocating inorgani... 30 3.3 At5g61100.1 68418.m07666 hypothetical protein 29 4.4 At4g26190.1 68417.m03770 expressed protein 29 4.4 At5g41950.1 68418.m05108 expressed protein 29 5.8 At2g34590.1 68415.m04250 transketolase family protein similar to... 29 5.8 At1g75820.1 68414.m08807 CLAVATA1 receptor kinase (CLV1) identic... 29 5.8 At1g30120.1 68414.m03681 pyruvate dehydrogenase E1 component bet... 29 5.8 At4g13930.1 68417.m02156 glycine hydroxymethyltransferase, putat... 29 7.7 At1g62680.1 68414.m07074 pentatricopeptide (PPR) repeat-containi... 29 7.7 At1g14850.1 68414.m01776 non-repetitive/WGA-negative nucleoporin... 29 7.7 >At3g08670.1 68416.m01007 expressed protein Length = 567 Score = 33.9 bits (74), Expect = 0.20 Identities = 39/146 (26%), Positives = 62/146 (42%), Gaps = 9/146 (6%) Query: 24 SLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDDLLLVLISGGGSA--LL 81 +LD+F+K R + + D LPD SA+ L + + I KDDLL G LL Sbjct: 44 NLDLFSKIRR-SFPLASSDELPDVSAKLGRLSVGSKIAPKGKDDLLSSAEGGKNDYDWLL 102 Query: 82 PLPKSPITLEEKIGL-VKKLANSGADIKELNTVRKVISDLKGGQLAVKAQPAQVVSLILS 140 P +P+ + L K+A+S R +S + G + ++PA+ S+ Sbjct: 103 TPPGTPLGNDSHSSLAAPKIASSARASSASKASRLSVSQSESGYHS--SRPARSSSVTRP 160 Query: 141 DIVGDPLDLIASG---PTVQNTDGAN 163 I SG ++ NT A+ Sbjct: 161 SISTSQYSSFTSGRSPSSILNTSSAS 186 >At1g48660.1 68414.m05446 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 573 Score = 32.7 bits (71), Expect = 0.47 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 5/110 (4%) Query: 220 IELNYLPLVLSNKVTGNVQDVANKYSKLVTVICKYLRQNLEIDELKSNIKKLE--ISGTD 277 +EL L ++ +N +QD K + +YL++ L+ K KK +S D Sbjct: 5 VELKDLEVLTTN--AKQIQDDVLKEILTLNANTEYLKRFLDGSSDKELFKKNVPVVSYND 62 Query: 278 LKVLNEIKISNKKPLCLILGGEITVAVKGTGKGGRNQQLALEFSKYLHKV 327 +K E +++N +P +I GG IT V+ TG G ++ KY+ + Sbjct: 63 VKPYIE-RVANGEPSDVISGGTITRFVQSTGTSGGIHKIFPVNDKYIENL 111 >At3g48820.2 68416.m05332 glycosyl transferase family 29 protein / sialyltransferase family protein contains Pfam profile: PF00777 sialyltransferase (Glycosyltransferase family 29) Length = 431 Score = 32.3 bits (70), Expect = 0.63 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 4/58 (6%) Query: 253 KYLRQNLEIDELKSNIKKLEISGTDL--KVLNEIKISNKKPLCLILGGEITVAVKGTG 308 K L + +E+DE K + ++ + D+ K++ E+ I N P+ L+LG A KGTG Sbjct: 220 KALDKVVELDEKKQEVLLVKTTIHDIMNKMIREVPIKN--PVYLMLGASFGSAAKGTG 275 >At3g48820.1 68416.m05331 glycosyl transferase family 29 protein / sialyltransferase family protein contains Pfam profile: PF00777 sialyltransferase (Glycosyltransferase family 29) Length = 440 Score = 32.3 bits (70), Expect = 0.63 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 4/58 (6%) Query: 253 KYLRQNLEIDELKSNIKKLEISGTDL--KVLNEIKISNKKPLCLILGGEITVAVKGTG 308 K L + +E+DE K + ++ + D+ K++ E+ I N P+ L+LG A KGTG Sbjct: 229 KALDKVVELDEKKQEVLLVKTTIHDIMNKMIREVPIKN--PVYLMLGASFGSAAKGTG 284 >At3g23670.1 68416.m02976 phragmoplast-associated kinesin-related protein, putative similar to kinesin like protein GB:CAB10194 from [Arabidopsis thaliana] Length = 1313 Score = 32.3 bits (70), Expect = 0.63 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 1/84 (1%) Query: 41 KDNLPDNSAQNTALKIKNLITQLNKDDLLLVLISGGGSALLPLPKSPITLEEKIGLVKKL 100 K LP + LK K LI + D+ + + +S G ++ K P EE+ +VKK+ Sbjct: 61 KSPLPPRPPSSNPLKRK-LIAEATADNGVAIGVSDSGVKVIVRMKPPSKGEEEEMIVKKI 119 Query: 101 ANSGADIKELNTVRKVISDLKGGQ 124 +N I E I+D + Q Sbjct: 120 SNDALTINEQTFTFDSIADPESTQ 143 >At4g28080.1 68417.m04027 expressed protein Length = 1660 Score = 31.9 bits (69), Expect = 0.83 Identities = 29/127 (22%), Positives = 54/127 (42%), Gaps = 6/127 (4%) Query: 98 KKLANSGADIKELNTVRKVIS--DLKGGQLAVKAQPAQVVSLILSDIVGDPLDLIASGPT 155 K S A +++N ++S +K G+L + A + IV + L P Sbjct: 1181 KSALASSACTEQINKPTPMLSPVSVKAGKLFSYKEVALAPPGTIVKIVAEQLPEETKAP- 1239 Query: 156 VQNTDGANKAVDVLKKYNLIDALPKSVQTLLENNGDNLVFPTNNTSNYIIGSNKISTKAA 215 QN D A AVD +K N DA ++ E +N N ++G +++++ Sbjct: 1240 -QNLDAAKIAVDGPEKVNAQDAESENKHVATETEAENT--DCNEQGRVVVGGSELTSSPK 1296 Query: 216 VVQCIEL 222 ++ +E+ Sbjct: 1297 EIKNVEV 1303 >At1g48670.1 68414.m05447 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 525 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/43 (32%), Positives = 26/43 (60%) Query: 285 KISNKKPLCLILGGEITVAVKGTGKGGRNQQLALEFSKYLHKV 327 +++N +P +I GG IT+ ++ TG G Q++ KY+ K+ Sbjct: 70 RVANGEPSDVISGGPITMFLRSTGTSGGKQKVFPVNDKYIEKL 112 >At4g09650.1 68417.m01585 ATP synthase delta chain, chloroplast, putative / H(+)-transporting two-sector ATPase, delta (OSCP) subunit, putative similar to SP|P32980 ATP synthase delta chain, chloroplast precursor (EC 3.6.3.14) {Nicotiana tabacum}; contains Pfam profile PF00213: ATP synthase F1, delta subunit Length = 234 Score = 31.5 bits (68), Expect = 1.1 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 12/100 (12%) Query: 125 LAVKAQPAQVVSLILSDIVGDPLDLIASGPTVQNTDGANKAVDVLKKYNLIDALPKSVQT 184 LA A+ + L ++DI + L+ + S P V N AN + V KK +ID + KS Sbjct: 59 LADVAKRNDTMELTVTDI--EKLEQVFSDPQVLNFF-ANPTITVEKKRQVIDDIVKS--- 112 Query: 185 LLENNGDNLVFPTNNTSNYIIGSNKISTKAAVVQCIELNY 224 +L T+N N ++ +N+I+ +V+ EL Y Sbjct: 113 ------SSLQSHTSNFLNVLVDANRINIVTEIVKEFELVY 146 >At5g06970.1 68418.m00789 expressed protein Length = 1101 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Query: 55 KIKNLITQLNKDDLLLVLISGGGSALLPLPKSPITLEEKIGLVKKLANSGAD 106 +I + Q + D LL VL+ GG S + +S + LEE + ++K+ SG D Sbjct: 969 RIVTSLLQASLDGLLRVLLDGGASRVFHPSESKL-LEEDVEVLKEFFISGGD 1019 >At1g17360.1 68414.m02116 COP1-interacting protein-related similar to COP1-Interacting Protein 7 (CIP7) (GI:3327870) [Arabidopsis thaliana] Length = 1032 Score = 30.3 bits (65), Expect = 2.5 Identities = 45/196 (22%), Positives = 80/196 (40%), Gaps = 10/196 (5%) Query: 103 SGADIKELNTVRKVISDLKGGQLAVKA-QPAQVVSLILSDIVGDPLDLIASGPTVQNTDG 161 S +E N K++S G+ A K+ Q +V S S V P +++ T NT G Sbjct: 634 SSLQSEEENEKDKLVSGQSIGKGASKSSQVRKVPSPNGSSRVSKPSGKVSNTNT--NTSG 691 Query: 162 ANKAVDVLKKYNLIDALPKSVQTLLENNGDNLVFPTNNTS---NYIIGSNKISTKAAVVQ 218 + +K +LPK EN + + N T+ NK +TK + Sbjct: 692 RGRKTSEIKLVTQ-SSLPKFSDLKKENTKPSSLAGRNTTTMMRTQARNGNKKTTKEDIPS 750 Query: 219 CIELNYLPLVLSNKVTGNVQ--DVANKYSKLVTVICKYLRQNLEIDELKSNIKKLEISGT 276 + + P L + N++ ++ YS + + +QN +ID++ N+K T Sbjct: 751 PV-MPRRPRSLRKSFSANIEFTELTTLYSDDMMNKERNQKQNTDIDDVSENLKNEAFDDT 809 Query: 277 DLKVLNEIKISNKKPL 292 + + E K + P+ Sbjct: 810 ESEAEEEEKEVLENPV 825 >At1g78920.1 68414.m09201 vacuolar-type H+-translocating inorganic pyrophosphatase (AVPL1) identical to vacuolar-type H+-translocating inorganic pyrophosphatase GI:6901676 from [Arabidopsis thaliana] Length = 802 Score = 29.9 bits (64), Expect = 3.3 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 1/83 (1%) Query: 84 PKSPITLEEKIG-LVKKLANSGADIKELNTVRKVISDLKGGQLAVKAQPAQVVSLILSDI 142 P++P + + +G V A GAD+ E + + + GG +A K + IL + Sbjct: 294 PRNPAVIADLVGDNVGDCAARGADLFESIAAEIISAMILGGTMAKKCKIEDPSGFILFPL 353 Query: 143 VGDPLDLIASGPTVQNTDGANKA 165 V DLI S + + G A Sbjct: 354 VVHSFDLIISSIGILSIKGTRDA 376 >At1g16780.1 68414.m02016 vacuolar-type H+-translocating inorganic pyrophosphatase, putative similar to vacuolar-type H+-translocating inorganic pyrophosphatase GI:6901676 from [Arabidopsis thaliana] Length = 802 Score = 29.9 bits (64), Expect = 3.3 Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 1/83 (1%) Query: 84 PKSPITLEEKIG-LVKKLANSGADIKELNTVRKVISDLKGGQLAVKAQPAQVVSLILSDI 142 P++P + + +G V A GAD+ E + + + GG +A K + IL + Sbjct: 294 PRNPAVIADLVGDNVGDCAARGADLFESIAAEIISAMILGGTMAQKCKIEDPSGFILFPL 353 Query: 143 VGDPLDLIASGPTVQNTDGANKA 165 V DL+ S + + G A Sbjct: 354 VVHSFDLVISSIGILSIKGTRNA 376 >At5g61100.1 68418.m07666 hypothetical protein Length = 227 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/52 (26%), Positives = 26/52 (50%) Query: 154 PTVQNTDGANKAVDVLKKYNLIDALPKSVQTLLENNGDNLVFPTNNTSNYII 205 P + TD ++ + V+ NLI+A P S + +N D + + SN ++ Sbjct: 128 PPIDQTDPSSTTIQVVDNENLIEAAPSSRSNQVVDNKDWIEAAPSLRSNQVV 179 >At4g26190.1 68417.m03770 expressed protein Length = 1067 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 239 DVANKYSKLVTVICKYLRQNLEIDELKSNIKKLEISGTDL--KVLNEIKISNKK 290 +V K SK + + N+E D +K N KK E+ DL + ++++++ KK Sbjct: 715 EVTTKKSKKKKNLLDHKTDNMEEDSIKKNEKKEEVDQNDLGAEGVSKVEVKTKK 768 >At5g41950.1 68418.m05108 expressed protein Length = 565 Score = 29.1 bits (62), Expect = 5.8 Identities = 19/67 (28%), Positives = 38/67 (56%), Gaps = 5/67 (7%) Query: 55 KIKNLITQLNKDDLLLVLISGGGSALLPLPKSPITLEEKIGLVKKLANSGADIKELNTVR 114 ++++++T K DL V +S GGS +P+ + + E ++KK D + T+R Sbjct: 94 EVQSVVTD-TKPDLTDVDLSPGGSEEIPIRSTEVEQESTTSVLKK----DDDGNKTFTMR 148 Query: 115 KVISDLK 121 +++S+LK Sbjct: 149 ELLSELK 155 >At2g34590.1 68415.m04250 transketolase family protein similar to SP|O66113 Pyruvate dehydrogenase E1 component, beta subunit (EC 1.2.4.1). {Zymomonas mobilis}; contains Pfam profiles PF02779: Transketolase, pyridine binding domain, PF02780: Transketolase, C-terminal domain Length = 406 Score = 29.1 bits (62), Expect = 5.8 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 6/99 (6%) Query: 230 SNKVTGNVQDVANKYSKLVTVICKYLRQNLEIDELKSNIKKLEISGTDLKVL----NEIK 285 S KVT + D L T IC+ + I + ++ + I G ++ L N+I Sbjct: 119 SYKVTKGLADKFGDLRVLDTPICENAFTGMGIGAAMTGLRPV-IEGMNMGFLLLAFNQIS 177 Query: 286 ISNKKPLCLILGGEITVAVKGTGKGGRNQQLALEFSKYL 324 +N L GG+ T+ V G GG +QL E S+ L Sbjct: 178 -NNCGMLHYTSGGQFTIPVVIRGPGGVGRQLGAEHSQRL 215 >At1g75820.1 68414.m08807 CLAVATA1 receptor kinase (CLV1) identical to receptor kinase (CLV1) GB:AAB58929 GI:2160756 [Arabidopsis thaliana] Length = 980 Score = 29.1 bits (62), Expect = 5.8 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 5/66 (7%) Query: 218 QCIELNYLPLV--LSNKVTGNVQDVANKYSKLVTVICKYLRQNLEIDELKSNIKK---LE 272 + EL +L + +N +TG + D ++ S L++V R N EI + +N+K L Sbjct: 499 EIFELKHLSRINTSANNITGGIPDSISRCSTLISVDLSRNRINGEIPKGINNVKNLGTLN 558 Query: 273 ISGTDL 278 ISG L Sbjct: 559 ISGNQL 564 >At1g30120.1 68414.m03681 pyruvate dehydrogenase E1 component beta subunit, chloroplast identical to pyruvate dehydrogenase E1 beta subunit [Arabidopsis thaliana] GI:2454184; identical to cDNA pyruvate dehydrogenase E1 beta subunit mRNA, nuclear gene encoding plastid protein GI:2454183 Length = 406 Score = 29.1 bits (62), Expect = 5.8 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 6/99 (6%) Query: 230 SNKVTGNVQDVANKYSKLVTVICKYLRQNLEIDELKSNIKKLEISGTDLKVL----NEIK 285 S KVT + D L T IC+ + I + ++ + I G ++ L N+I Sbjct: 119 SYKVTKGLADKFGDLRVLDTPICENAFTGMGIGAAMTGLRPV-IEGMNMGFLLLAFNQIS 177 Query: 286 ISNKKPLCLILGGEITVAVKGTGKGGRNQQLALEFSKYL 324 +N L GG+ T+ V G GG +QL E S+ L Sbjct: 178 -NNCGMLHYTSGGQFTIPVVIRGPGGVGRQLGAEHSQRL 215 >At4g13930.1 68417.m02156 glycine hydroxymethyltransferase, putative / serine hydroxymethyltransferase, putative / serine/threonine aldolase, putative similar to serine hydroxymethyltransferase [Chlamydomonas reinhardtii] GI:17066746; contains Pfam profile PF00464: serine hydroxymethyltransferase Length = 471 Score = 28.7 bits (61), Expect = 7.7 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Query: 229 LSNKVTGNVQDVANKYSKLVTVICKYLRQNLEIDELKSNIKKLEIS 274 LS VT + D+ Y KL+ K L N ++D+LK++++K S Sbjct: 412 LSRAVTLTL-DIQKTYGKLLKDFNKGLVNNKDLDQLKADVEKFSAS 456 >At1g62680.1 68414.m07074 pentatricopeptide (PPR) repeat-containing protein contains multiple PPR repeats Pfam Profile: PF01535 Length = 542 Score = 28.7 bits (61), Expect = 7.7 Identities = 32/155 (20%), Positives = 73/155 (47%), Gaps = 10/155 (6%) Query: 118 SDLKGGQLAVKAQPAQVVSLILSDIVGDPLDLIASGP--TVQNTDGANKAVDVLKKYNLI 175 S + GG L + ++ + L+D + D++ S P ++ + + A+ LKKY+++ Sbjct: 39 SSVSGGDLRERLSKTRLRDIKLNDAIDLFSDMVKSRPFPSIVDFNRLLSAIVKLKKYDVV 98 Query: 176 DALPKSVQTLLENNGDNLVFPTNNTSNYIIGSNKISTKAAVV-QCIELNYLP--LVLSNK 232 +L K ++ L N ++ N N ++S +++ + ++L Y P + + + Sbjct: 99 ISLGKKMEVLGIRND---LYTFNIVINCFCCCFQVSLALSILGKMLKLGYEPDRVTIGSL 155 Query: 233 VTGNVQDVANKYSKLVTVICKYLRQNLEIDELKSN 267 V G + N+ S V+++ K + + D + N Sbjct: 156 VNGFCR--RNRVSDAVSLVDKMVEIGYKPDIVAYN 188 >At1g14850.1 68414.m01776 non-repetitive/WGA-negative nucleoporin family protein contains Pfam profile: PF03177 non-repetitive/WGA-negative nucleoporin Length = 1464 Score = 28.7 bits (61), Expect = 7.7 Identities = 24/94 (25%), Positives = 42/94 (44%), Gaps = 2/94 (2%) Query: 235 GNVQDVANKYSKLVTVICKYLRQNLEIDELKSNIKKLEISGTDLKVLNEIKISNKKPLCL 294 G + V N Y +L++ NL I L+S + L + VL++ S+ L Sbjct: 1344 GAAEPVLNAYDRLLSNAAVVPSPNLRIRLLRSVLVVLREWA--MSVLSDRMGSSPTRSSL 1401 Query: 295 ILGGEITVAVKGTGKGGRNQQLALEFSKYLHKVK 328 ILGG + K G ++A ++Y+ +V+ Sbjct: 1402 ILGGSFALENKAALNQGARDKIANAANRYMTEVR 1435 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.314 0.135 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,626,403 Number of Sequences: 28952 Number of extensions: 423946 Number of successful extensions: 918 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 16 Number of HSP's that attempted gapping in prelim test: 913 Number of HSP's gapped (non-prelim): 21 length of query: 421 length of database: 12,070,560 effective HSP length: 83 effective length of query: 338 effective length of database: 9,667,544 effective search space: 3267629872 effective search space used: 3267629872 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -