BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000827-TA|BGIBMGA000827-PA|IPR007835|MOFRL (421 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 9.4 AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 22 9.4 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 22 9.4 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 9.4 Identities = 11/33 (33%), Positives = 15/33 (45%) Query: 115 KVISDLKGGQLAVKAQPAQVVSLILSDIVGDPL 147 KV+ L G LAV SL+ +V P+ Sbjct: 490 KVLEPLYSGNLAVSVATPNDTSLVRGRLVAKPV 522 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 21.8 bits (44), Expect = 9.4 Identities = 20/79 (25%), Positives = 29/79 (36%) Query: 313 NQQLALEFSKYLHKVKDQLNDFDIFILSAGTDGIDGPTDAAGAIGYLNLISESTADGLDV 372 N+ A + L K ++ + IF L GT + T G ++ G D Sbjct: 2 NEPTAAAIAYGLDKKAEKERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDF 61 Query: 373 DKYLANNDTYNFFKLFKND 391 D L T +F K K D Sbjct: 62 DNRLVEYCTQDFKKKHKAD 80 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 21.8 bits (44), Expect = 9.4 Identities = 20/79 (25%), Positives = 29/79 (36%) Query: 313 NQQLALEFSKYLHKVKDQLNDFDIFILSAGTDGIDGPTDAAGAIGYLNLISESTADGLDV 372 N+ A + L K ++ + IF L GT + T G ++ G D Sbjct: 2 NEPTAAAIAYGLDKKAERERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDF 61 Query: 373 DKYLANNDTYNFFKLFKND 391 D L T +F K K D Sbjct: 62 DNRLVEYCTQDFKKKHKAD 80 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.135 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,616 Number of Sequences: 317 Number of extensions: 3891 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 3 length of query: 421 length of database: 114,650 effective HSP length: 59 effective length of query: 362 effective length of database: 95,947 effective search space: 34732814 effective search space used: 34732814 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -