BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000827-TA|BGIBMGA000827-PA|IPR007835|MOFRL (421 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 25 2.9 AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine p... 25 3.9 AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825730-1|AAV70293.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825726-1|AAV70289.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine p... 25 5.1 AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine p... 25 5.1 AY825712-1|AAV70275.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine p... 25 5.1 AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine p... 25 5.1 AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825689-1|AAV70252.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine p... 25 5.1 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 24 8.9 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 24 8.9 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 25.4 bits (53), Expect = 2.9 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Query: 157 QNTDGANKAVDVLKKYNLIDALPKSVQTLLENNGDNLVFPTNNTSNYIIGSNKISTKA 214 QNT G K ++K L DAL + T+ ++ FPTN T + ++ T A Sbjct: 173 QNTRG--KIQSIIKPDLLQDALMMLINTIYFKGSWSIPFPTNATVERPFFTGRMHTAA 228 >AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 3.9 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SVPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825730-1|AAV70293.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825726-1|AAV70289.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825712-1|AAV70275.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 77 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 125 >AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 77 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 125 >AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825689-1|AAV70252.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 5.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Query: 19 SIPMGSLDVFNKSRNVEYFEGAKDNLPDNSAQNTALKIKNLITQLNKDD 67 S+P G+ N+S+ EY EG +D ++ A +N+ L KD+ Sbjct: 75 SLPNGTAVKENRSKWDEYCEGLRDYQTAQISKLDAENAENVYQALLKDN 123 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.8 bits (49), Expect = 8.9 Identities = 11/37 (29%), Positives = 20/37 (54%) Query: 236 NVQDVANKYSKLVTVICKYLRQNLEIDELKSNIKKLE 272 +VQ ++N+ S + C L+Q +D + I+K E Sbjct: 165 HVQRLSNQRSHYKRIQCYSLKQRSLVDAFQKTIRKAE 201 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 23.8 bits (49), Expect = 8.9 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 5/57 (8%) Query: 161 GANKAVDVLKKYNLIDALPKSVQTLLENNGDNLVFPTNNTSNYII---GSNKISTKA 214 GANK + + L +S+Q +L+ NG L P+N + SN++S + Sbjct: 142 GANKKLSKVDTLRLAVEYIRSLQRMLDENGGEL--PSNKQQQQLTSASSSNQLSNSS 196 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.314 0.135 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 405,713 Number of Sequences: 2123 Number of extensions: 17798 Number of successful extensions: 67 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 53 length of query: 421 length of database: 516,269 effective HSP length: 66 effective length of query: 355 effective length of database: 376,151 effective search space: 133533605 effective search space used: 133533605 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -