GeneModel BLAST Result against uniref50

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000824-TA|BGIBMGA000824-PA|undefined
         (211 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q08XZ7 Cluster: Putative keratin associated protein; n=...    34   2.2  

>UniRef50_Q08XZ7 Cluster: Putative keratin associated protein; n=1;
           Stigmatella aurantiaca DW4/3-1|Rep: Putative keratin
           associated protein - Stigmatella aurantiaca DW4/3-1
          Length = 277

 Score = 34.3 bits (75), Expect = 2.2
 Identities = 21/68 (30%), Positives = 27/68 (39%), Gaps = 2/68 (2%)

Query: 27  PTGAAAHETIAPFRSEPFSDGGIAAAECGPRSVVSPVPDRF--LGGVSACGEVDARSGDG 84
           PTG   +   A    +    GGI+   C P +  +  PD F   G   AC  V+A   D 
Sbjct: 149 PTGCCMNGYCAVSTFQTCGTGGISCTACNPATADACSPDGFCACGSAPACNPVNADRCDK 208

Query: 85  RACGAGER 92
             C  G R
Sbjct: 209 GRCRCGNR 216


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.321    0.136    0.419 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 200,304,686
Number of Sequences: 1657284
Number of extensions: 7015739
Number of successful extensions: 12671
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 12671
Number of HSP's gapped (non-prelim): 1
length of query: 211
length of database: 575,637,011
effective HSP length: 97
effective length of query: 114
effective length of database: 414,880,463
effective search space: 47296372782
effective search space used: 47296372782
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 70 (32.3 bits)